WB (Western Blot)
(WB Suggested Anti-LAPTM4B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that LAPTM4B is expressed in HEK293T)
Rabbit LAPTM4B Polyclonal Antibody | anti-LAPTM4B antibody
LAPTM4B antibody - middle region
Gene Names
LAPTM4B; LC27; LAPTM4beta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
LAPTM4B, Antibody; LAPTM4B antibody - middle region; anti-LAPTM4B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS
Sequence Length
317
Applicable Applications for anti-LAPTM4B antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LAPTM4B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-LAPTM4B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that LAPTM4B is expressed in HEK293T)
WB (Western Blot)
(WB Suggested Anti-LAPTM4B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that LAPTM4B is expressed in HEK293T)
WB (Western Blot)
(Host: RabbitTarget Name: LAPTM4BSample Tissue: Human MDA-MB-435s Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: LAPTM4BSample Tissue: Human MDA-MB-435s Whole CellAntibody Dilution: 1ug/ml)
IHC (Immunohistochemistry)
(Rabbit Anti-LAPTM4B AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Membrane and cytoplasmic in processes of pinealocytes and intersticial cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-LAPTM4B AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Membrane and cytoplasmic in processes of pinealocytes and intersticial cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-LAPTM4B antibody
This is a rabbit polyclonal antibody against LAPTM4B. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: LAPTM4B is a multi-pass membrane protein. It belongs to the LAPTM4/LAPTM5 transporter family. LAPTM4b has active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.
Target Description: LAPTM4B is a multi-pass membrane protein. It belongs to the LAPTM4/LAPTM5 transporter family. LAPTM4b has active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.
Product Categories/Family for anti-LAPTM4B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
lysosomal-associated transmembrane protein 4B
NCBI Official Synonym Full Names
lysosomal protein transmembrane 4 beta
NCBI Official Symbol
LAPTM4B
NCBI Official Synonym Symbols
LC27; LAPTM4beta
NCBI Protein Information
lysosomal-associated transmembrane protein 4B
UniProt Protein Name
Lysosomal-associated transmembrane protein 4B
UniProt Gene Name
LAPTM4B
UniProt Entry Name
LAP4B_HUMAN
Similar Products
Product Notes
The LAPTM4B laptm4b (Catalog #AAA199803) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LAPTM4B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LAPTM4B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the LAPTM4B laptm4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YPNSIQEYIR QLPPNFPYRD DVMSVNPTCL VLIILLFISI ILTFKGYLIS. It is sometimes possible for the material contained within the vial of "LAPTM4B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.