Rabbit LASS3 Polyclonal Antibody | anti-CERS3 antibody
LASS3 antibody - N-terminal region
Gene Names
CERS3; ARCI9; LASS3
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LASS3, Antibody; LASS3 antibody - N-terminal region; anti-CERS3 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
RVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLA
Applicable Applications for anti-CERS3 antibody
WB (Western Blot)
Protein Size (# AA)
383 amino acids
Blocking Peptide
For anti-CERS3 (MBS3200533) antibody is Catalog # MBS3225585.
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LASS3
Predicted Homology
Cow: 92%; Dog: 93%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 85%; Rabbit: 77%; Rat: 77%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-CERS3 antibody
SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis.
Product Categories/Family for anti-CERS3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
ceramide synthase 3 isoform 2
NCBI Official Synonym Full Names
ceramide synthase 3
NCBI Official Symbol
CERS3
NCBI Official Synonym Symbols
ARCI9; LASS3
NCBI Protein Information
ceramide synthase 3
UniProt Protein Name
Ceramide synthase 3
UniProt Gene Name
CERS3
UniProt Synonym Gene Names
LASS3; CerS3
UniProt Entry Name
CERS3_HUMAN
Similar Products
Product Notes
The CERS3 cers3 (Catalog #AAA197203) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LASS3 antibody - N-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's LASS3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CERS3 cers3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RVFEKFVASP LAKSFGIKET VRKVTPNTVL ENFFKHSTRQ PLQTDIYGLA. It is sometimes possible for the material contained within the vial of "LASS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
