Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200399_WB13.jpg WB (Western Blot) (WB Suggested Anti-LCN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit LCN1 Polyclonal Antibody | anti-LCN1 antibody

LCN1 antibody - middle region

Gene Names
LCN1; TP; TLC; PMFA; VEGP
Reactivity
Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LCN1, Antibody; LCN1 antibody - middle region; anti-LCN1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG
Sequence Length
176
Applicable Applications for anti-LCN1 antibody
WB (Western Blot)
Homology
Human: 100%; Mouse: 79%; Pig: 79%; Rat: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LCN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-LCN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA200399_WB13.jpg WB (Western Blot) (WB Suggested Anti-LCN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: LCN1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200399_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: LCN1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-LCN1 antibody
This is a rabbit polyclonal antibody against LCN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LCN1 could play a role in taste reception. LCN1 could be necessary for the concentration and delivery of sapid molecules in the gustatory system. LCN1 can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. LCN1 exhibits an extremely wide ligand pocket.The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-LCN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
lipocalin-1 isoform 1
NCBI Official Synonym Full Names
lipocalin 1
NCBI Official Symbol
LCN1
NCBI Official Synonym Symbols
TP; TLC; PMFA; VEGP
NCBI Protein Information
lipocalin-1
UniProt Protein Name
Lipocalin-1
UniProt Gene Name
LCN1
UniProt Synonym Gene Names
VEGP; Tlc; TP; VEG protein
UniProt Entry Name
LCN1_HUMAN

Similar Products

Product Notes

The LCN1 lcn1 (Catalog #AAA200399) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LCN1 antibody - middle region reacts with Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LCN1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the LCN1 lcn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IRSHVKDHYI FYCEGELHGK PVRGVKLVGR DPKNNLEALE DFEKAAGARG. It is sometimes possible for the material contained within the vial of "LCN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.