Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201140_WB10.jpg WB (Western Blot) (WB Suggested Anti-C2orf43 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Rabbit LDAH Polyclonal Antibody | anti-LDAH antibody

LDAH Antibody - C-terminal region

Gene Names
LDAH; hLDAH; C2orf43
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
LDAH, Antibody; LDAH Antibody - C-terminal region; anti-LDAH antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAFIT
Sequence Length
325
Applicable Applications for anti-LDAH antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 86%; Rabbit: 100%; Rat: 89%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-C2orf43 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

product-image-AAA201140_WB10.jpg WB (Western Blot) (WB Suggested Anti-C2orf43 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

WB (Western Blot)

(Host: RabbitTarget Name: C2orf43Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlC2orf43 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

product-image-AAA201140_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: C2orf43Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlC2orf43 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

WB (Western Blot)

(Host: RabbitTarget Name: C2orf43Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA201140_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: C2orf43Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-C2orf43 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Membrane, Cytoplasm in hepatocytes, moderate signal, moderate tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA201140_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-C2orf43 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Membrane, Cytoplasm in hepatocytes, moderate signal, moderate tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-LDAH antibody
This is a rabbit polyclonal antibody against C2orf43. It was validated on Western Blot
Product Categories/Family for anti-LDAH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
lipid droplet-associated hydrolase isoform a
NCBI Official Synonym Full Names
lipid droplet associated hydrolase
NCBI Official Symbol
LDAH
NCBI Official Synonym Symbols
hLDAH; C2orf43
NCBI Protein Information
lipid droplet-associated hydrolase
UniProt Protein Name
UPF0554 protein C2orf43
UniProt Gene Name
C2orf43
UniProt Entry Name
CB043_HUMAN

Similar Products

Product Notes

The LDAH c2orf43 (Catalog #AAA201140) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LDAH Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LDAH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the LDAH c2orf43 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TIKEHLCKLT FYYGTIDPWC PKEYYEDIKK DFPEGDIRLC EKNIPHAFIT. It is sometimes possible for the material contained within the vial of "LDAH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.