Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23530_WB12.jpg WB (Western Blot) (WB Suggested Anti-LDHB AntibodyTitration: 1 ug/mlPositive Control: 721_B Whole CellLDHB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit LDHB Polyclonal Antibody | anti-LDHB antibody

LDHB Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
LDHB; LDH-B; LDH-H; LDHBD; TRG-5; HEL-S-281
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
LDHB, Antibody; LDHB Antibody - C-terminal region; anti-LDHB antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
Sequence Length
334
Applicable Applications for anti-LDHB antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LDHB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-LDHB AntibodyTitration: 1 ug/mlPositive Control: 721_B Whole CellLDHB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA23530_WB12.jpg WB (Western Blot) (WB Suggested Anti-LDHB AntibodyTitration: 1 ug/mlPositive Control: 721_B Whole CellLDHB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(WB Suggested Anti-LDHB antibody Titration: 1 ug/mLSample Type: Human Raji)

product-image-AAA23530_WB11.jpg WB (Western Blot) (WB Suggested Anti-LDHB antibody Titration: 1 ug/mLSample Type: Human Raji)

WB (Western Blot)

(WB Suggested Anti-LDHB antibody Titration: 1 ug/mLSample Type: Human 721_B)

product-image-AAA23530_WB10.jpg WB (Western Blot) (WB Suggested Anti-LDHB antibody Titration: 1 ug/mLSample Type: Human 721_B)

WB (Western Blot)

(Lanes:1. 30 ug MiaPaca-2 cell lysate2. 30 ug Panc-1 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-Rabbit HRPSecondary Antibody Dilution:1:4000Gene Name:LDHBSubmitted by:Dr. Crissy Dudgeon, Ph.D., CINJ)

product-image-AAA23530_WB9.jpg WB (Western Blot) (Lanes:1. 30 ug MiaPaca-2 cell lysate2. 30 ug Panc-1 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-Rabbit HRPSecondary Antibody Dilution:1:4000Gene Name:LDHBSubmitted by:Dr. Crissy Dudgeon, Ph.D., CINJ)

WB (Western Blot)

(Host: RabbitTarget Name: LDHBSample Type:Lane A: Human Fetal LungLane B: Human HCT116Lane C: Human 293TAntibody Dilution: 0.2ug/ml)

product-image-AAA23530_WB8.jpg WB (Western Blot) (Host: RabbitTarget Name: LDHBSample Type:Lane A: Human Fetal LungLane B: Human HCT116Lane C: Human 293TAntibody Dilution: 0.2ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: LDHBSample Type: Human Fetal LungLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

product-image-AAA23530_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: LDHBSample Type: Human Fetal LungLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

WB (Western Blot)

(Host: RabbitTarget Name: LDHBSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23530_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: LDHBSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: LDHBSample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

product-image-AAA23530_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: LDHBSample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: LDHBSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23530_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: LDHBSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: LDHBSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23530_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: LDHBSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Researcher: Dr. Crissy Dudgeon, Ph.D., CINJApplication: IHCSpecies+tissue/cell type: Human lung adenocarcinoma cell line A549Primary antibody dilution: 1:100Secondary antibody: Goat anti-rabbit AlexaFluor 488Secondary antibody dilution: 1:400)

product-image-AAA23530_IHC2.jpg IHC (Immunohistochemistry) (Researcher: Dr. Crissy Dudgeon, Ph.D., CINJApplication: IHCSpecies+tissue/cell type: Human lung adenocarcinoma cell line A549Primary antibody dilution: 1:100Secondary antibody: Goat anti-rabbit AlexaFluor 488Secondary antibody dilution: 1:400)

IHC (Immunohistochemistry)

(Rabbit Anti-LDHB AntibodyParaffin Embedded Tissue: Human PlacentaAntibody Concentration: 5 ug/ml)

product-image-AAA23530_IHC.jpg IHC (Immunohistochemistry) (Rabbit Anti-LDHB AntibodyParaffin Embedded Tissue: Human PlacentaAntibody Concentration: 5 ug/ml)
Related Product Information for anti-LDHB antibody
This is a rabbit polyclonal antibody against LDHB. It was validated on Western Blot

Target Description: This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have been found for this gene. Recent studies have shown that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on chromosomes X, 5 and 13.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
L-lactate dehydrogenase B chain isoform LDHB
NCBI Official Synonym Full Names
lactate dehydrogenase B
NCBI Official Symbol
LDHB
NCBI Official Synonym Symbols
LDH-B; LDH-H; LDHBD; TRG-5; HEL-S-281
NCBI Protein Information
L-lactate dehydrogenase B chain
UniProt Protein Name
L-lactate dehydrogenase B chain
UniProt Gene Name
LDHB
UniProt Synonym Gene Names
LDH-B; LDH-H
UniProt Entry Name
LDHB_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LDHB ldhb (Catalog #AAA23530) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LDHB Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LDHB can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the LDHB ldhb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MYGIENEVFL SLPCILNARG LTSVINQKLK DDEVAQLKKS ADTLWDIQKD. It is sometimes possible for the material contained within the vial of "LDHB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.