Rabbit LGALS3BP Polyclonal Antibody | anti-LGALS3BP antibody
LGALS3BP Antibody - middle region
Gene Names
LGALS3BP; 90K; M2BP; gp90; CyCAP; BTBD17B; MAC-2-BP; TANGO10B
Reactivity
Cow, Dog, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LGALS3BP, Antibody; LGALS3BP Antibody - middle region; anti-LGALS3BP antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS
Sequence Length
585
Applicable Applications for anti-LGALS3BP antibody
WB (Western Blot)
Homology
Cow: 83%; Dog: 83%; Human: 100%; Mouse: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LGALS3BP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-LGALS3BP antibody
This is a rabbit polyclonal antibody against LGALS3BP. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.
Target Description: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.
Product Categories/Family for anti-LGALS3BP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
galectin-3-binding protein
NCBI Official Synonym Full Names
galectin 3 binding protein
NCBI Official Symbol
LGALS3BP
NCBI Official Synonym Symbols
90K; M2BP; gp90; CyCAP; BTBD17B; MAC-2-BP; TANGO10B
NCBI Protein Information
galectin-3-binding protein
UniProt Protein Name
Galectin-3-binding protein
UniProt Gene Name
LGALS3BP
UniProt Synonym Gene Names
M2BP; MAC2BP; Mac-2 BP
UniProt Entry Name
LG3BP_HUMAN
Similar Products
Product Notes
The LGALS3BP lgals3bp (Catalog #AAA200424) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LGALS3BP Antibody - middle region reacts with Cow, Dog, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LGALS3BP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the LGALS3BP lgals3bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLSLYWSHEA LFQKKTLQAL EFHTVPFQLL ARYKGLNLTE DTYKPRIYTS. It is sometimes possible for the material contained within the vial of "LGALS3BP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
