IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human pituitary gland tissue using LHB/CGB1 Rabbit pAb (AAA283248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)
Rabbit anti-Human LHB/CGB1 Polyclonal Antibody | anti-LHB antibody
LHB/CGB1 Rabbit pAb
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
LHB/CGB1, Antibody; LHB/CGB1 Rabbit pAb; LHB; CGB4; HH23; LSH-B; LSH-beta; lutropin subunit beta; Lutropin subunit beta; anti-LHB antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
Applicable Applications for anti-LHB antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant Protein corresponding to a sequence within amino acids 21-141of human LHB(NP_000885.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human pituitary gland tissue using LHB/CGB1 Rabbit pAb (AAA283248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human pituitary gland tissue using LHB/CGB1 Rabbit pAb (AAA283248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and 293T cells transfected with LHB/CGB1 using Lutropin subunit beta Rabbit pAb (AAA283248) at 1:800 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and 293T cells transfected with LHB/CGB1 using Lutropin subunit beta Rabbit pAb (AAA283248) at 1:800 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and 293T cells transfected with LHB/CGB1 using Lutropin subunit beta Rabbit pAb (AAA283248) at 1:800 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and 293T cells transfected with LHB/CGB1 using Lutropin subunit beta Rabbit pAb (AAA283248) at 1:800 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
Related Product Information for anti-LHB antibody
This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism.
Product Categories/Family for anti-LHB antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The LHB lhb (Catalog #AAA283248) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LHB/CGB1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LHB/CGB1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the LHB lhb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SREPLRPWCH PINAILAVEK EGCPVCITVN TTICAGYCPT MMRVLQAVLP PLPQVVCTYR DVRFESIRLP GCPRGVDPVV SFPVALSCRC GPCRRSTSDC GGPKDHPLTC DHPQLSGLLF L. It is sometimes possible for the material contained within the vial of "LHB/CGB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.