Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201772_WB13.jpg WB (Western Blot) (WB Suggested Anti-LHX1 Antibody Titration: 0.4ug/mlPositive Control: HepG2 cell lysate)

Rabbit LHX1 Polyclonal Antibody | anti-LHX1 antibody

LHX1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
LHX1; LIM1; LIM-1
Reactivity
Cow, Human, Mouse, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
LHX1, Antibody; LHX1 antibody - C-terminal region; anti-LHX1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW
Sequence Length
406
Applicable Applications for anti-LHX1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human LHX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-LHX1 Antibody Titration: 0.4ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA201772_WB13.jpg WB (Western Blot) (WB Suggested Anti-LHX1 Antibody Titration: 0.4ug/mlPositive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Human Liver)

product-image-AAA201772_IHC15.jpg IHC (Immunohistochemistry) (Human Liver)
Related Product Information for anti-LHX1 antibody
This is a rabbit polyclonal antibody against LHX1. It was validated on Western Blot and immunohistochemistry

Target Description: LHX1 is a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. It may function as a transcriptional regulator and be involved in control of differentiation and development of neural and lymphoid cells. A similar protein in mice is an essential regulator of the vertebrate head organizer.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
LIM/homeobox protein Lhx1
NCBI Official Synonym Full Names
LIM homeobox 1
NCBI Official Symbol
LHX1
NCBI Official Synonym Symbols
LIM1; LIM-1
NCBI Protein Information
LIM/homeobox protein Lhx1
UniProt Protein Name
LIM/homeobox protein Lhx1
UniProt Gene Name
LHX1
UniProt Synonym Gene Names
LIM-1; LIM1; LIM homeobox protein 1; hLim-1
UniProt Entry Name
LHX1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LHX1 lhx1 (Catalog #AAA201772) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LHX1 antibody - C-terminal region reacts with Cow, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LHX1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the LHX1 lhx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PEPSLPGPLH SMSAEVFGPS PPFSSLSVNG GASYGNHLSH PPEMNEAAVW. It is sometimes possible for the material contained within the vial of "LHX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.