Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197550_WB13.jpg WB (Western Blot) (WB Suggested Anti-LHX5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysateLHX5 is supported by BioGPS gene expression data to be expressed in COLO205)

Rabbit LHX5 Polyclonal Antibody | anti-LHX5 antibody

LHX5 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
LHX5, Antibody; LHX5 antibody - middle region; anti-LHX5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGP
Sequence Length
402
Applicable Applications for anti-LHX5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LHX5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-LHX5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysateLHX5 is supported by BioGPS gene expression data to be expressed in COLO205)

product-image-AAA197550_WB13.jpg WB (Western Blot) (WB Suggested Anti-LHX5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysateLHX5 is supported by BioGPS gene expression data to be expressed in COLO205)

IHC (Immunohistochemistry)

(Sample Type :Embryonic mouse spinal cordPrimary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: Lhx5 Cyan: Nissl(Neurons)Gene Name :LHX5Submitted by :Joshua R. Sanes, Molecular and Cellular Biology, Harvard University, 52 Oxford Street, Room 335, Cambridge MA 02138, Phone: 617-496-8683, FAX: 617-495-0524, email: sanesj@mcb.harvard.edu)

product-image-AAA197550_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Embryonic mouse spinal cordPrimary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: Lhx5 Cyan: Nissl(Neurons)Gene Name :LHX5Submitted by :Joshua R. Sanes, Molecular and Cellular Biology, Harvard University, 52 Oxford Street, Room 335, Cambridge MA 02138, Phone: 617-496-8683, FAX: 617-495-0524, email: sanesj@mcb.harvard.edu)
Related Product Information for anti-LHX5 antibody
This is a rabbit polyclonal antibody against LHX5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LHX5 plays an essential role in the regulation of neuronal differentiation and migration during development of the central nervous system.This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in the control of differentiation and development of the forebrain. In mice, this protein is essential for the regulation of precursor cell proliferation and the control of neuronal differentiation and migration during hippocampal development. This protein is involved in learning and motor functions in adult mice.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
LIM/homeobox protein Lhx5
NCBI Official Synonym Full Names
LIM homeobox 5
NCBI Official Symbol
LHX5
NCBI Protein Information
LIM/homeobox protein Lhx5
UniProt Protein Name
LIM/homeobox protein Lhx5
UniProt Gene Name
LHX5
UniProt Synonym Gene Names
LIM homeobox protein 5
UniProt Entry Name
LHX5_HUMAN

Similar Products

Product Notes

The LHX5 lhx5 (Catalog #AAA197550) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LHX5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LHX5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the LHX5 lhx5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FFRSPRRMRP LGGRLDESEM LGSTPYTYYG DYQGDYYAPG SNYDFFAHGP. It is sometimes possible for the material contained within the vial of "LHX5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.