Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201247_WB13.jpg WB (Western Blot) (WB Suggested Anti-LILRB2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit anti-Human LILRB2 Polyclonal Antibody | anti-LILRB2 antibody

LILRB2 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
LILRB2; ILT4; LIR2; CD85D; ILT-4; LIR-2; MIR10; MIR-10
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LILRB2, Antibody; LILRB2 antibody - C-terminal region; anti-LILRB2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLA
Sequence Length
598
Applicable Applications for anti-LILRB2 antibody
WB (Western Blot)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-LILRB2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

product-image-AAA201247_WB13.jpg WB (Western Blot) (WB Suggested Anti-LILRB2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

WB (Western Blot)

(Host: RabbitTarget Name: LILRB2Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201247_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: LILRB2Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-LILRB2 antibody
This is a rabbit polyclonal antibody against LILRB2. It was validated on Western Blot

Target Description: This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-LILRB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
leukocyte immunoglobulin-like receptor subfamily B member 2 isoform 1
NCBI Official Synonym Full Names
leukocyte immunoglobulin like receptor B2
NCBI Official Symbol
LILRB2
NCBI Official Synonym Symbols
ILT4; LIR2; CD85D; ILT-4; LIR-2; MIR10; MIR-10
NCBI Protein Information
leukocyte immunoglobulin-like receptor subfamily B member 2
UniProt Protein Name
Leukocyte immunoglobulin-like receptor subfamily B member 2
UniProt Gene Name
LILRB2
UniProt Synonym Gene Names
ILT4; LIR2; MIR10; LIR-2; Leukocyte immunoglobulin-like receptor 2; ILT-4; MIR-10
UniProt Entry Name
LIRB2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LILRB2 lilrb2 (Catalog #AAA201247) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LILRB2 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LILRB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the LILRB2 lilrb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDTRAAASEA PQDVTYAQLH SLTLRRKATE PPPSQEREPP AEPSIYATLA. It is sometimes possible for the material contained within the vial of "LILRB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.