liver FABP Polyclonal Antibody | anti-FABP antibody

Anti-liver FABP Antibody

Cat. Num. AAA46277

• Gene Names: FABP1; FABPL; L-FABP
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: liver FABP, Antibody; Anti-liver FABP Antibody; Fatty acid-binding protein; FABP 1; FABP1; FABP-1; FABPL; FABPL_HUMAN; Fatty Acid Binding Protein 1; Fatty acid binding protein 1 liver; Fatty Acid Binding Protein; Fatty acid-binding protein 1; Fatty acid-binding protein liver; L FABP; L-FABP; liver; Liver-type fatty acid-binding protein; fatty acid binding protein 1, liver; anti-FABP antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 127

• Applicable Applications for anti-FABP antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- liver FABP Picoband antibody, AAA46277,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- liver FABP Picoband antibody, AAA46277,IHC(P)IHC(P): Rat Intestine Tissue)

IHC (Immunohiostchemistry)

(Anti- liver FABP Picoband antibody, AAA46277,IHC(P)IHC(P): Mouse Intestine Tissue)

WB (Western Blot)

(Anti- liver FABP Picoband antibody, AAA46277, Western blottingAll lanes: Anti liver FABP (AAA46277) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: SMMC Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: RH35 Whole Cell Lysate at 40ugPredicted bind size: 14KDObserved bind size: 14KD)

Related Product Information for anti-FABP antibody

Description: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, liver(FABP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.

References

1. Sparkes, R. S.; Mohandas, T.; Heinzmann, C.; Gordon, J. I.; Klisak, I.; Zollman, S.; Sweetser, D. A.; Ragunathan, L.; Winokur, S.; Lusis, A. J. : Human fatty acid binding protein assignments: intestinal to 4q28-4q31 and liver to 2p11. (Abstract) Cytogenet. Cell Genet. 46: 697 only, 1987. 2. Sweetser, D. A.; Birkenmeier, E. H.; Klisak, I. J.; Zollman, S.; Sparkes, R. S.; Mohandas, T.; Lusis, A. J.; Gordon, J. I. : The human and rodent intestinal fatty acid binding protein genes: a comparative analysis of their structure, expression, and linkage relationships. J. Biol. Chem. 262: 16060-16071, 1987.

NCBI and Uniprot Product Information

• NCBI GI #: 4557577
• NCBI GeneID: 2168
• NCBI Accession #: NP_001434.1
• NCBI GenBank Nucleotide #: NM_001443.2
• UniProt Accession #: P07148
• Molecular Weight: 14,208 Da
• NCBI Official Full Name: fatty acid-binding protein, liver
• NCBI Official Synonym Full Names: fatty acid binding protein 1
• NCBI Official Symbol: FABP1
• NCBI Official Synonym Symbols: FABPL; L-FABP
• NCBI Protein Information: fatty acid-binding protein, liver
• UniProt Protein Name: Fatty acid-binding protein, liver
• UniProt Gene Name: FABP1
• UniProt Synonym Gene Names: FABPL; L-FABP
• UniProt Entry Name: FABPL_HUMAN