Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200277_WB15.jpg WB (Western Blot) (WB Suggested Anti-LIX1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

Rabbit LIX1L Polyclonal Antibody | anti-LIX1L antibody

LIX1L antibody - N-terminal region

Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LIX1L, Antibody; LIX1L antibody - N-terminal region; anti-LIX1L antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Applicable Applications for anti-LIX1L antibody
WB (Western Blot)
Protein Size (# AA)
337 amino acids
Peptide Sequence
Synthetic peptide located within the following region: AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKN
Blocking Peptide
For anti-LIX1L (MBS3211190) antibody is Catalog #
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LIX1L
Replacement Item
This antibody may replace item sc-243269 from Santa Cruz Biotechnology.
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-LIX1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

product-image-AAA200277_WB15.jpg WB (Western Blot) (WB Suggested Anti-LIX1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)
Related Product Information for anti-LIX1L antibody
Description of Target: The exact functions of LIX1L remain unknown.
Product Categories/Family for anti-LIX1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
LIX1-like protein
NCBI Official Synonym Full Names
limb and CNS expressed 1 like
NCBI Official Symbol
LIX1L
NCBI Protein Information
LIX1-like protein
UniProt Protein Name
LIX1-like protein
UniProt Gene Name
LIX1L
UniProt Entry Name
LIX1L_HUMAN

Similar Products

Product Notes

The LIX1L lix1l (Catalog #AAA200277) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIX1L antibody - N-terminal region reacts with Tested: Human Predicted: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LIX1L can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the LIX1L lix1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LIX1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.