WB (Western Blot)
(WB Suggested Anti-LMNB2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateLMNB2 is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit LMNB2 Polyclonal Antibody | anti-LMNB2 antibody
LMNB2 antibody - N-terminal region
Gene Names
LMNB2; EPM9; LMN2; LAMB2
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
LMNB2, Antibody; LMNB2 antibody - N-terminal region; anti-LMNB2 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE
Sequence Length
600
Applicable Applications for anti-LMNB2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LMNB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-LMNB2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateLMNB2 is supported by BioGPS gene expression data to be expressed in Jurkat)
WB (Western Blot)
(WB Suggested Anti-LMNB2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateLMNB2 is supported by BioGPS gene expression data to be expressed in Jurkat)
IHC (Immunohistochemistry)
(Researcher: Dr. David Razafsky, Washington University in Saint LouisApplication: IHCSpecies + Tissue/Cell type: Mouse C2C12 cellsPrimary antibody dilution: 1:500Secondary antibody: Goat anti-rabbit-Alexa Fluor 488Secondary antibody dilution: 1:500)
IHC (Immunohistochemistry)
(Researcher: Dr. David Razafsky, Washington University in Saint LouisApplication: IHCSpecies + Tissue/Cell type: Mouse C2C12 cellsPrimary antibody dilution: 1:500Secondary antibody: Goat anti-rabbit-Alexa Fluor 488Secondary antibody dilution: 1:500)
Related Product Information for anti-LMNB2 antibody
This is a rabbit polyclonal antibody against LMNB2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B2. This gene is in a head-to-tail orientation with the gene for the translocase of inner mitochondrial membrane 13 homolog gene.
Target Description: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B2. This gene is in a head-to-tail orientation with the gene for the translocase of inner mitochondrial membrane 13 homolog gene.
Product Categories/Family for anti-LMNB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
lamin-B2
NCBI Official Synonym Full Names
lamin B2
NCBI Official Symbol
LMNB2
NCBI Official Synonym Symbols
EPM9; LMN2; LAMB2
NCBI Protein Information
lamin-B2
UniProt Protein Name
Lamin-B2
UniProt Gene Name
LMNB2
UniProt Synonym Gene Names
LMN2
UniProt Entry Name
LMNB2_HUMAN
Similar Products
Product Notes
The LMNB2 lmnb2 (Catalog #AAA199695) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LMNB2 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LMNB2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the LMNB2 lmnb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MATPLPGRAG GPATPLSPTR LSRLQEKEEL RELNDRLAHY IDRVRALELE. It is sometimes possible for the material contained within the vial of "LMNB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.