Rabbit LRP8 Polyclonal Antibody | anti-LRP8 antibody
LRP8 antibody
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
LRP8, Antibody; LRP8 antibody; Polyclonal LRP8; Anti-LRP8; LRP 8; LRP-8; APOER2; MCI1; HSZ75190; LRP8; Low Density Lipoprotein Receptor-Related Protein 8 Apolipoprotein E Receptor; anti-LRP8 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
LRP8 antibody was raised against the middle region of LRP8
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRP8 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-LRP8 antibody
WB (Western Blot)
Biological Significance
LRP8 is an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL).
Cross-Reactivity
Human,Mouse,Rat
Immunogen
LRP8 antibody was raised using the middle region of LRP8 corresponding to a region with amino acids ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-LRP8 antibody
Rabbit polyclonal LRP8 antibody raised against the middle region of LRP8
Product Categories/Family for anti-LRP8 antibody
Similar Products
Product Notes
The LRP8 (Catalog #AAA224373) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRP8 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LRP8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the LRP8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LRP8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
