Rabbit Lynx1 Polyclonal Antibody | anti-LYNX1 antibody
Lynx1 antibody - middle region
Gene Names
Lynx1; SLURP-2; AI838844
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Lynx1, Antibody; Lynx1 antibody - middle region; anti-LYNX1 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PAMATYCMTTRTYFTPYRMKVRKSCVPSCFETVYDGYSKHASATSCCQYY
Sequence Length
116
Applicable Applications for anti-LYNX1 antibody
WB (Western Blot)
Homology
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-LYNX1 antibody
This is a rabbit polyclonal antibody against Lynx1. It was validated on Western Blot
Target Description: Lynx1 seems to modulate nicotinic acetylcholine receptors. It promotes the largest of three current amplitudes elicited by ACh through alpha4beta2 nAChRs and that LYNX1 enhances desensitization.
Target Description: Lynx1 seems to modulate nicotinic acetylcholine receptors. It promotes the largest of three current amplitudes elicited by ACh through alpha4beta2 nAChRs and that LYNX1 enhances desensitization.
Product Categories/Family for anti-LYNX1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13kDa
NCBI Official Full Name
ly-6/neurotoxin-like protein 1
NCBI Official Synonym Full Names
Ly6/neurotoxin 1
NCBI Official Symbol
Lynx1
NCBI Official Synonym Symbols
SLURP-2; AI838844
NCBI Protein Information
ly-6/neurotoxin-like protein 1
UniProt Protein Name
Ly-6/neurotoxin-like protein 1
UniProt Gene Name
Lynx1
UniProt Synonym Gene Names
Slurp2; SLURP-2
UniProt Entry Name
LYNX1_MOUSE
Similar Products
Product Notes
The LYNX1 lynx1 (Catalog #AAA200846) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Lynx1 antibody - middle region reacts with Cow, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Lynx1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the LYNX1 lynx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PAMATYCMTT RTYFTPYRMK VRKSCVPSCF ETVYDGYSKH ASATSCCQYY. It is sometimes possible for the material contained within the vial of "Lynx1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
