Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46311_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Lysozyme Picoband antibody, AAA46311, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

anti-Human, Rat Lysozyme Polyclonal Antibody | anti-LYZ antibody

Anti-Lysozyme Antibody

Average rating 0.0
No ratings yet
Gene Names
LYZ; LZM; LYZF1
Reactivity
Human, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Lysozyme, Antibody; Anti-Lysozyme Antibody; Lysozyme C; 1 4 beta n acetylmuramidase c; 1; 4-beta-N-acetylmuramidase C; EC 3.2.1.17; LYSC_HUMAN; Lysosyme; Lysozyme (renal amyloidosis); Lysozyme C precursor; Lyz; LZM; Renal amyloidosis; lysozyme; anti-LYZ antibody
Ordering
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
148
Applicable Applications for anti-LYZ antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- Lysozyme Picoband antibody, AAA46311, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

product-image-AAA46311_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Lysozyme Picoband antibody, AAA46311, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

WB (Western Blot)

(Anti- Lysozyme Picoband antibody, AAA46311, Western blottingAll lanes: Anti Lysozyme (AAA46311) at 0.5ug/mlLane 1: Rat Intestine Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Rat Liver Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: SW620 Whole Cell Lysate at 40ugLane 6: 293T Whole Cell Lysate at 40ugLane 7: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 17KDObserved bind size: 17KD)

product-image-AAA46311_WB15.jpg WB (Western Blot) (Anti- Lysozyme Picoband antibody, AAA46311, Western blottingAll lanes: Anti Lysozyme (AAA46311) at 0.5ug/mlLane 1: Rat Intestine Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Rat Liver Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: SW620 Whole Cell Lysate at 40ugLane 6: 293T Whole Cell Lysate at 40ugLane 7: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 17KDObserved bind size: 17KD)
Related Product Information for anti-LYZ antibody
Description: Rabbit IgG polyclonal antibody for Lysozyme C(LYZ) detection. Tested with WB, IHC-P in Human;Rat.

Background: In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.
References
1. McKenzie HA, White FH (1991). "Lysozyme and alpha-lactalbumin: structure, function, and interrelationships". Adv. Protein Chem. 41: 173-315. 2. Peters CW, Kruse U, Pollwein R, Grzeschik KH, Sippel AE (July 1989). "The human lysozyme gene. Sequence organization and chromosomal localization". Eur. J. Biochem. 182 (3): 507-16. 3. Yoshimura K, Toibana A, Nakahama K (January 1988). "Human lysozyme: sequencing of a cDNA, and expression and secretion by Saccharomyces cerevisiae". Biochem. Biophys. Res. Commun. 150 (2): 794-801.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,537 Da
NCBI Official Full Name
lysozyme C
NCBI Official Synonym Full Names
lysozyme
NCBI Official Symbol
LYZ
NCBI Official Synonym Symbols
LZM; LYZF1
NCBI Protein Information
lysozyme C
UniProt Protein Name
Lysozyme C
UniProt Gene Name
LYZ
UniProt Synonym Gene Names
LZM
UniProt Entry Name
LYSC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LYZ lyz (Catalog #AAA46311) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Lysozyme Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Lysozyme can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the LYZ lyz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Lysozyme, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.