Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199668_WB13.jpg WB (Western Blot) (WB Suggested Anti-MAGEA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)

Rabbit anti-Human MAGEA3 Polyclonal Antibody | anti-MAGEA3 antibody

MAGEA3 antibody - middle region

Gene Names
MAGEA3; HIP8; HYPD; CT1.3; MAGE3; MAGEA6
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
MAGEA3, Antibody; MAGEA3 antibody - middle region; anti-MAGEA3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD
Sequence Length
314
Applicable Applications for anti-MAGEA3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAGEA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MAGEA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)

product-image-AAA199668_WB13.jpg WB (Western Blot) (WB Suggested Anti-MAGEA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)

IHC (Immunohistochemistry)

(Testis)

product-image-AAA199668_IHC15.jpg IHC (Immunohistochemistry) (Testis)
Related Product Information for anti-MAGEA3 antibody
This is a rabbit polyclonal antibody against MAGEA3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-MAGEA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
melanoma-associated antigen 3
NCBI Official Synonym Full Names
MAGE family member A3
NCBI Official Symbol
MAGEA3
NCBI Official Synonym Symbols
HIP8; HYPD; CT1.3; MAGE3; MAGEA6
NCBI Protein Information
melanoma-associated antigen 3
UniProt Protein Name
Melanoma-associated antigen 3
UniProt Gene Name
MAGEA3
UniProt Synonym Gene Names
MAGE3; CT1.3
UniProt Entry Name
MAGA3_HUMAN

Similar Products

Product Notes

The MAGEA3 magea3 (Catalog #AAA199668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAGEA3 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAGEA3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MAGEA3 magea3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APEEKIWEEL SVLEVFEGRE DSILGDPKKL LTQHFVQENY LEYRQVPGSD. It is sometimes possible for the material contained within the vial of "MAGEA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.