Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA21305_IHC6.jpg IHC (Immunohistchemistry) (MAOA/Monoamine Oxidase Antibody-Immunohistochemistry of paraffin-embedded rat kidney using MAOA antibody at dilution of 1:100 (400x lens).)

Rabbit MAOA/Monoamine Oxidase Polyclonal Antibody | anti-MAOA antibody

MAOA/Monoamine Oxidase Rabbit anti-Human Polyclonal Antibody

Gene Names
MAOA; MAO-A
Reactivity
Mouse, Rat, Human
Applications
Immunohistochemistry, Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
MAOA/Monoamine Oxidase, Antibody; MAOA/Monoamine Oxidase Rabbit anti-Human Polyclonal Antibody; IHC-plus MAOA/Monoamine Oxidase Antibody; MAOA; MAO-A; Monoamine Oxidase; Monoamine oxidase A; Monoamine oxidase type A; anti-MAOA antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human MAOA/Monoamine Oxidase
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Applicable Applications for anti-MAOA antibody
IHC (Immunohistochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC: 1:50-1:200
IHC-P: 1:200
WB: 1:500-1:2000
The predicted MW is 44kDa/59kDa, while the observed MW by Western blot was 65kDa.
Target
Human MAOA/Monoamine Oxidase
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human MAOA (NP_000231.1). MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLN
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistchemistry)

(MAOA/Monoamine Oxidase Antibody-Immunohistochemistry of paraffin-embedded rat kidney using MAOA antibody at dilution of 1:100 (400x lens).)

product-image-AAA21305_IHC6.jpg IHC (Immunohistchemistry) (MAOA/Monoamine Oxidase Antibody-Immunohistochemistry of paraffin-embedded rat kidney using MAOA antibody at dilution of 1:100 (400x lens).)

IHC (Immunohistochemistry)

(MAOA/Monoamine Oxidase Antibody-Immunohistochemistry of paraffin-embedded mouse kidney using MAOA antibody at dilution of 1:100 (400x lens).)

product-image-AAA21305_IHC5.jpg IHC (Immunohistochemistry) (MAOA/Monoamine Oxidase Antibody-Immunohistochemistry of paraffin-embedded mouse kidney using MAOA antibody at dilution of 1:100 (400x lens).)

IHC (Immunohistochemistry)

(MAOA/Monoamine Oxidase Antibody-Immunohistochemistry of paraffin-embedded human liver cancer tissue.)

product-image-AAA21305_IHC4.jpg IHC (Immunohistochemistry) (MAOA/Monoamine Oxidase Antibody-Immunohistochemistry of paraffin-embedded human liver cancer tissue.)

IHC (Immunohistochemistry)

(MAOA/Monoamine Oxidase Antibody-Immunohistochemistry of paraffin-embedded rat spleen using MAOA antibody at dilution of 1:100 (400x lens).)

product-image-AAA21305_IHC3.jpg IHC (Immunohistochemistry) (MAOA/Monoamine Oxidase Antibody-Immunohistochemistry of paraffin-embedded rat spleen using MAOA antibody at dilution of 1:100 (400x lens).)

IHC (Immunohistochemistry)

(MAOA/Monoamine Oxidase Antibody-Human Prostate: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA21305_IHC2.jpg IHC (Immunohistochemistry) (MAOA/Monoamine Oxidase Antibody-Human Prostate: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(MAOA/Monoamine Oxidase Antibody-Western blot analysis of extracts of various cell lines, using MAOA antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.)

product-image-AAA21305_WB.jpg WB (Western Blot) (MAOA/Monoamine Oxidase Antibody-Western blot analysis of extracts of various cell lines, using MAOA antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.)
Related Product Information for anti-MAOA antibody
Monoamine Oxidase antibody is an unconjugated rabbit polyclonal antibody to Monoamine Oxidase (MAOA) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,848 Da
NCBI Official Full Name
amine oxidase
NCBI Official Synonym Full Names
monoamine oxidase A
NCBI Official Symbol
MAOA
NCBI Official Synonym Symbols
MAO-A
NCBI Protein Information
amine oxidase [flavin-containing] A
UniProt Protein Name
Amine oxidase [flavin-containing] A
UniProt Gene Name
MAOA
UniProt Synonym Gene Names
MAO-A
UniProt Entry Name
AOFA_HUMAN

Similar Products

Product Notes

The MAOA maoa (Catalog #AAA21305) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAOA/Monoamine Oxidase Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAOA/Monoamine Oxidase can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), IHC (Immunohistochemistry), WB (Western Blot). IHC: 1:50-1:200 IHC-P: 1:200 WB: 1:500-1:2000 The predicted MW is 44kDa/59kDa, while the observed MW by Western blot was 65kDa. Researchers should empirically determine the suitability of the MAOA maoa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAOA/Monoamine Oxidase, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.