Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199968_WB11.jpg WB (Western Blot) (WB Suggested Anti-MAP2K2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that MAP2K2 is expressed in HepG2)

Rabbit MAP2K2 Polyclonal Antibody | anti-MAP2K2 antibody

MAP2K2 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
MAP2K2; CFC4; MEK2; MKK2; MAPKK2; PRKMK2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MAP2K2, Antibody; MAP2K2 antibody - C-terminal region; anti-MAP2K2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV
Sequence Length
400
Applicable Applications for anti-MAP2K2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MAP2K2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MAP2K2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that MAP2K2 is expressed in HepG2)

product-image-AAA199968_WB11.jpg WB (Western Blot) (WB Suggested Anti-MAP2K2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that MAP2K2 is expressed in HepG2)

IHC (Immunohiostchemistry)

(MAP2K2 antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199968_IHC13.jpg IHC (Immunohiostchemistry) (MAP2K2 antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Human Pancreas)

product-image-AAA199968_IHC15.jpg IHC (Immunohistochemistry) (Human Pancreas)
Related Product Information for anti-MAP2K2 antibody
This is a rabbit polyclonal antibody against MAP2K2. It was validated on Western Blot and immunohistochemistry

Target Description: MAP2K2 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in MAP2K2 gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
dual specificity mitogen-activated protein kinase kinase 2
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase 2
NCBI Official Symbol
MAP2K2
NCBI Official Synonym Symbols
CFC4; MEK2; MKK2; MAPKK2; PRKMK2
NCBI Protein Information
dual specificity mitogen-activated protein kinase kinase 2
UniProt Protein Name
Dual specificity mitogen-activated protein kinase kinase 2
UniProt Gene Name
MAP2K2
UniProt Synonym Gene Names
MEK2; MKK2; PRKMK2; MAP kinase kinase 2; MAPKK 2; MEK 2
UniProt Entry Name
MP2K2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MAP2K2 map2k2 (Catalog #AAA199968) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP2K2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MAP2K2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MAP2K2 map2k2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IKNPAERADL KMLTNHTFIK RSEVEEVDFA GWLCKTLRLN QPGTPTRTAV. It is sometimes possible for the material contained within the vial of "MAP2K2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.