Rabbit anti-Human MAPK1 Polyclonal Antibody | anti-MAPK1 antibody
MAPK1 Antibody - middle region
Gene Names
MAPK1; ERK; p38; p40; p41; ERK2; ERT1; ERK-2; MAPK2; PRKM1; PRKM2; P42MAPK; p41mapk; p42-MAPK
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAPK1, Antibody; MAPK1 Antibody - middle region; anti-MAPK1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYD
Sequence Length
167
Applicable Applications for anti-MAPK1 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAPK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-MAPK1 antibody
This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.
Product Categories/Family for anti-MAPK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41 kDa
NCBI Official Full Name
mitogen-activated protein kinase 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase 1
NCBI Official Symbol
MAPK1
NCBI Official Synonym Symbols
ERK; p38; p40; p41; ERK2; ERT1; ERK-2; MAPK2; PRKM1; PRKM2; P42MAPK; p41mapk; p42-MAPK
NCBI Protein Information
mitogen-activated protein kinase 1
UniProt Protein Name
Mitogen-activated protein kinase 1
UniProt Gene Name
MAPK1
UniProt Synonym Gene Names
ERK2; PRKM1; PRKM2; MAP kinase 1; MAPK 1; ERK-2; p42-MAPK; MAP kinase 2; MAPK 2
UniProt Entry Name
MK01_HUMAN
Similar Products
Product Notes
The MAPK1 mapk1 (Catalog #AAA201544) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPK1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MAPK1 mapk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HKNKVPWNRL FPNADSKALD LLDKMLTFNP HKRIEVEQAL AHPYLEQYYD. It is sometimes possible for the material contained within the vial of "MAPK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
