Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23536_WB.jpg WB (Western Blot) (WB Suggested Anti-MOSC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

Rabbit MARC1 Polyclonal Antibody | anti-MARC1 antibody

MARC1 Antibody - C-terminal region

Gene Names
MARC1; MOSC1
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Synonyms
MARC1, Antibody; MARC1 Antibody - C-terminal region; anti-MARC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
WDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPS
Protein Size (# AA)
337 amino acids
Protein Interactions
PARK2; UBC; SLC25A46; RAB6C; MRPL39; MRPL15; ZC3H4; PDHX; SDHA; NDUFS4; NDUFB10; NDUFB4; ATP6V1B1;
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MOSC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

product-image-AAA23536_WB.jpg WB (Western Blot) (WB Suggested Anti-MOSC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)
Related Product Information for anti-MARC1 antibody
This is a rabbit polyclonal antibody against MOSC1. It was validated on Western Blot using a cell lysate as a positive control.
Product Categories/Family for anti-MARC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
mitochondrial amidoxime-reducing component 1
NCBI Official Synonym Full Names
mitochondrial amidoxime reducing component 1
NCBI Official Symbol
MARC1
NCBI Official Synonym Symbols
MOSC1
NCBI Protein Information
mitochondrial amidoxime-reducing component 1
UniProt Protein Name
Mitochondrial amidoxime-reducing component 1
UniProt Gene Name
MARC1
UniProt Synonym Gene Names
MOSC1; mARC1; MOSC domain-containing protein 1; Moco sulfurase C-terminal domain-containing protein 1

Similar Products

Product Notes

The MARC1 marc1 (Catalog #AAA23536) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MARC1 Antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: WDELLIGDVE LKRVMACSRC ILTTVDPDTG VMSRKEPLET LKSYRQCDPS. It is sometimes possible for the material contained within the vial of "MARC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.