Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200128_WB11.jpg WB (Western Blot) (WB Suggested Anti-MAS1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Rabbit MAS1 Polyclonal Antibody | anti-MAS1 antibody

MAS1 antibody - middle region

Gene Names
MAS1; MAS; MGRA
Reactivity
Guinea Pig, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
MAS1, Antibody; MAS1 antibody - middle region; anti-MAS1 antibody
Ordering
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI
Sequence Length
325
Applicable Applications for anti-MAS1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Guinea Pig: 77%; Human: 100%; Mouse: 77%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MAS1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA200128_WB11.jpg WB (Western Blot) (WB Suggested Anti-MAS1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: MAS1Sample Tissue: Human DLD1Antibody Dilution: 1.0ug/ml)

product-image-AAA200128_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MAS1Sample Tissue: Human DLD1Antibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA200128_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-MAS1 antibody
This is a rabbit polyclonal antibody against MAS1. It was validated on Western Blot and immunohistochemistry

Target Description: The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.The structure of the MAS1 product indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
proto-oncogene Mas
NCBI Official Synonym Full Names
MAS1 proto-oncogene, G protein-coupled receptor
NCBI Official Symbol
MAS1
NCBI Official Synonym Symbols
MAS; MGRA
NCBI Protein Information
proto-oncogene Mas
UniProt Protein Name
Proto-oncogene Mas
UniProt Gene Name
MAS1
UniProt Synonym Gene Names
MAS
UniProt Entry Name
MAS_HUMAN

Similar Products

Product Notes

The MAS1 mas1 (Catalog #AAA200128) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAS1 antibody - middle region reacts with Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MAS1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MAS1 mas1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RPKYQSALVC ALLWALSCLV TTMEYVMCID REEESHSRND CRAVIIFIAI. It is sometimes possible for the material contained within the vial of "MAS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.