Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198250_WB11.jpg WB (Western Blot) (WB Suggested Anti-MAZ Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateMAZ is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit MAZ Polyclonal Antibody | anti-MAZ antibody

MAZ antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
MAZ; PUR1; ZF87; Pur-1; SAF-1; SAF-2; SAF-3; Zif87; ZNF801
Reactivity
Human, Mouse, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
MAZ, Antibody; MAZ antibody - N-terminal region; anti-MAZ antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR
Sequence Length
477
Applicable Applications for anti-MAZ antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MAZ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MAZ Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateMAZ is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

product-image-AAA198250_WB11.jpg WB (Western Blot) (WB Suggested Anti-MAZ Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateMAZ is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

WB (Western Blot)

(Host: MouseTarget Name: MAZSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

product-image-AAA198250_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: MAZSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Human Breast)

product-image-AAA198250_IHC15.jpg IHC (Immunohistochemistry) (Human Breast)
Related Product Information for anti-MAZ antibody
This is a rabbit polyclonal antibody against MAZ. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MAZ may function as a transcription factor with dual roles in transcription initiation and termination.It binds to two sites, ME1a1 and ME1a2, within the c-myc promoter having greater affinity for the former. It also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
myc-associated zinc finger protein isoform 1
NCBI Official Synonym Full Names
MYC associated zinc finger protein
NCBI Official Symbol
MAZ
NCBI Official Synonym Symbols
PUR1; ZF87; Pur-1; SAF-1; SAF-2; SAF-3; Zif87; ZNF801
NCBI Protein Information
myc-associated zinc finger protein
UniProt Protein Name
Myc-associated zinc finger protein
UniProt Gene Name
MAZ
UniProt Synonym Gene Names
ZNF801; MAZI; SAF-1
UniProt Entry Name
MAZ_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MAZ maz (Catalog #AAA198250) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAZ antibody - N-terminal region reacts with Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MAZ can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MAZ maz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FPVFPCTLLA PPFPVLGLDS RGVGGLMNSF PPPQGHAQNP LQVGAELQSR. It is sometimes possible for the material contained within the vial of "MAZ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.