Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199932_WB11.jpg WB (Western Blot) (WB Suggested Anti-MBOAT1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit MBOAT1 Polyclonal Antibody | anti-MBOAT1 antibody

MBOAT1 antibody - N-terminal region

Gene Names
MBOAT1; LPLAT; LPSAT; OACT1; LPEAT1; LPLAT 1; dJ434O11.1
Reactivity
Tested Species Reactivity: Human
Predicted: Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MBOAT1, Antibody; MBOAT1 antibody - N-terminal region; anti-MBOAT1 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted: Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 0.5- 1mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR
Sequence Length
495
Applicable Applications for anti-MBOAT1 antibody
WB (Western Blot)
Homology
Horse: 100%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 86%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MBOAT1
Protein Size
495 amino acids
Replacement Item
This antibody may replace item sc-75757 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MBOAT1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA199932_WB11.jpg WB (Western Blot) (WB Suggested Anti-MBOAT1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: MBOAT1Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199932_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MBOAT1Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MBOAT1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199932_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MBOAT1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-MBOAT1 antibody
This is a rabbit polyclonal antibody against MBOAT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets.MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets (Dauwerse et al., 2007 [PubMed 17440500]).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-304 AL158198.14 79926-80229 c 305-450 AL158198.14 20414-20559 c 451-528 AL158198.14 18975-19052 c 529-624 AL158198.14 12010-12105 c 625-680 AL355139.10 10796-10851 c 681-735 AL355139.10 8351-8405 c 736-919 AL355139.10 6169-6352 c 920-1112 AL355139.10 4060-4252 c 1113-1216 AL008627.1 1909-2012 1217-1281 AL008627.1 5097-5161 1282-1414 AL008627.1 7441-7573 1415-1566 AL008627.1 10700-10851 1567-3275 AL008627.1 18037-19745
Product Categories/Family for anti-MBOAT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
lysophospholipid acyltransferase 1
NCBI Official Synonym Full Names
membrane bound O-acyltransferase domain containing 1
NCBI Official Symbol
MBOAT1
NCBI Official Synonym Symbols
LPLAT; LPSAT; OACT1; LPEAT1; LPLAT 1; dJ434O11.1
NCBI Protein Information
lysophospholipid acyltransferase 1
UniProt Protein Name
Lysophospholipid acyltransferase 1
UniProt Gene Name
MBOAT1
UniProt Synonym Gene Names
OACT1; LPLAT 1; LPSAT; Lyso-PS acyltransferase; O-acyltransferase domain-containing protein 1
UniProt Entry Name
MBOA1_HUMAN

Similar Products

Product Notes

The MBOAT1 mboat1 (Catalog #AAA199932) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MBOAT1 antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted: Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MBOAT1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MBOAT1 mboat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAEPQPSSLS YRTTGSTYLH PLSELLGIPL DQVNFVVCQL VALFAAFWFR. It is sometimes possible for the material contained within the vial of "MBOAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.