Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201602_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MCHR1Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MCHR1 Polyclonal Antibody | anti-MCHR1 antibody

MCHR1 Antibody - C-terminal region

Gene Names
MCHR1; SLC1; GPR24; MCH1R; SLC-1; MCH-1R
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MCHR1, Antibody; MCHR1 Antibody - C-terminal region; anti-MCHR1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
Sequence Length
296
Applicable Applications for anti-MCHR1 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MCHR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: MCHR1Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

product-image-AAA201602_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MCHR1Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: MCHR1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA201602_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: MCHR1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)
Related Product Information for anti-MCHR1 antibody
The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin.
Product Categories/Family for anti-MCHR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
melanin-concentrating hormone receptor 1
NCBI Official Synonym Full Names
melanin concentrating hormone receptor 1
NCBI Official Symbol
MCHR1
NCBI Official Synonym Symbols
SLC1; GPR24; MCH1R; SLC-1; MCH-1R
NCBI Protein Information
melanin-concentrating hormone receptor 1

Similar Products

Product Notes

The MCHR1 (Catalog #AAA201602) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MCHR1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MCHR1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MCHR1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SCLNPFVYIV LCETFRKRLV LSVKPAAQGQ LRAVSNAQTA DEERTESKGT. It is sometimes possible for the material contained within the vial of "MCHR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.