WB (Western Blot)
(WB Suggested Anti-MCOLN3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)
Rabbit MCOLN3 Polyclonal Antibody | anti-MCOLN3 antibody
MCOLN3 antibody - middle region
Gene Names
MCOLN3; TRPML3; TRP-ML3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MCOLN3, Antibody; MCOLN3 antibody - middle region; anti-MCOLN3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI
Sequence Length
553
Applicable Applications for anti-MCOLN3 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MCOLN3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-MCOLN3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)
WB (Western Blot)
(WB Suggested Anti-MCOLN3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: MCOLN3Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: MCOLN3Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-MCOLN3 antibody
This is a rabbit polyclonal antibody against MCOLN3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The specific function of this protein remains unknown.Mucolipins constitute a family of cation channel proteins with homologs in mouse, Drosophila, and C. elegans. Mutations in the human MCOLN1 gene (MIM 605248) cause mucolipodosis IV (MIM 262650).[supplied by OMIM].
Target Description: The specific function of this protein remains unknown.Mucolipins constitute a family of cation channel proteins with homologs in mouse, Drosophila, and C. elegans. Mutations in the human MCOLN1 gene (MIM 605248) cause mucolipodosis IV (MIM 262650).[supplied by OMIM].
Product Categories/Family for anti-MCOLN3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
mucolipin-3 isoform 1
NCBI Official Synonym Full Names
mucolipin 3
NCBI Official Symbol
MCOLN3
NCBI Official Synonym Symbols
TRPML3; TRP-ML3
NCBI Protein Information
mucolipin-3
UniProt Protein Name
Mucolipin-3
UniProt Gene Name
MCOLN3
UniProt Synonym Gene Names
TRPML31 PublicationManual assertion based on opinion iniRef.4
Similar Products
Product Notes
The MCOLN3 mcoln3 (Catalog #AAA197954) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MCOLN3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MCOLN3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MCOLN3 mcoln3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVELQFKLKA INLQTVRHQE LPDCYDFTLT ITFDNKAHSG RIKISLDNDI. It is sometimes possible for the material contained within the vial of "MCOLN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.