Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199448_WB11.jpg WB (Western Blot) (WB Suggested Anti-MCTP1 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

Rabbit MCTP1 Polyclonal Antibody | anti-MCTP1 antibody

MCTP1 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
MCTP1, Antibody; MCTP1 antibody - middle region; anti-MCTP1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQELKPDPSHSP
Sequence Length
778
Applicable Applications for anti-MCTP1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MCTP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MCTP1 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

product-image-AAA199448_WB11.jpg WB (Western Blot) (WB Suggested Anti-MCTP1 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

IHC (Immunohiostchemistry)

(Rabbit Anti-MCTP1 AntibodyParaffin Embedded Tissue: Human SpleenAntibody Concentration: 5 ug/ml)

product-image-AAA199448_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-MCTP1 AntibodyParaffin Embedded Tissue: Human SpleenAntibody Concentration: 5 ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Human SpleenAnti-MCTP1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

product-image-AAA199448_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Human SpleenAnti-MCTP1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
Related Product Information for anti-MCTP1 antibody
This is a rabbit polyclonal antibody against MCTP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MCTP1 belongs to the MCTP family.It contains 3 C2 domains. MCTP1 is a multi-pass membrane protein. It binds calcium via the C2 domains in absence of phospholipids. The function of MCTP1 remains unknown.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
multiple C2 and transmembrane domain-containing protein 1 isoform S
NCBI Official Synonym Full Names
multiple C2 and transmembrane domain containing 1
NCBI Official Symbol
MCTP1
NCBI Protein Information
multiple C2 and transmembrane domain-containing protein 1
UniProt Protein Name
Multiple C2 and transmembrane domain-containing protein 1
UniProt Gene Name
MCTP1
UniProt Entry Name
MCTP1_HUMAN

Similar Products

Product Notes

The MCTP1 mctp1 (Catalog #AAA199448) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MCTP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MCTP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MCTP1 mctp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVWGINKFTK KLRSPYAIDN NELLDFLSRV PSDVQVVQYQ ELKPDPSHSP. It is sometimes possible for the material contained within the vial of "MCTP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.