Rabbit MCUB Polyclonal Antibody | anti-MCUB antibody
MCUB Antibody - middle region
Gene Names
Mcub; Ccdc109b; 9030408N13Rik
Reactivity
Tested Reactivity: MousePredicted Reactivity: Mouse
Purity
Affinity purified
Synonyms
MCUB, Antibody; MCUB Antibody - middle region; anti-MCUB antibody
Host
Rabbit
Reactivity
Tested Reactivity: Mouse
Predicted Reactivity: Mouse
Predicted Reactivity: Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
KHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIIT
Protein Size (# AA)
345 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse CCDC109B
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Product Categories/Family for anti-MCUB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
calcium uniporter regulatory subunit MCUb, mitochondrial isoform 2
NCBI Official Synonym Full Names
mitochondrial calcium uniporter dominant negative beta subunit
NCBI Official Symbol
Mcub
NCBI Official Synonym Symbols
Ccdc109b; 9030408N13Rik
NCBI Protein Information
calcium uniporter regulatory subunit MCUb, mitochondrial
UniProt Protein Name
Mitochondrial calcium uniporter regulatory subunit MCUb
UniProt Gene Name
Ccdc109b
UniProt Synonym Gene Names
Mcub; MCUb
UniProt Entry Name
MCUB_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The MCUB ccdc109b (Catalog #AAA23604) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MCUB Antibody - middle region reacts with Tested Reactivity: Mouse Predicted Reactivity: Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: KHGLPLVTLT LPSRKERCQF VVKPMLSTVG SFLQDLQNED KGIKTAAIIT. It is sometimes possible for the material contained within the vial of "MCUB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
