Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201527_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MDM2Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MDM2 Polyclonal Antibody | anti-MDM2 antibody

MDM2 Antibody - middle region

Gene Names
MDM2; HDMX; hdm2; ACTFS
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MDM2, Antibody; MDM2 Antibody - middle region; anti-MDM2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKA
Sequence Length
446
Applicable Applications for anti-MDM2 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human MDM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: MDM2Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201527_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MDM2Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-MDM2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201527_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-MDM2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-MDM2 antibody
This is a rabbit polyclonal antibody against MDM2. It was validated on Western Blot

Target Description: This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells.
Product Categories/Family for anti-MDM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase Mdm2 isoform a
NCBI Official Synonym Full Names
MDM2 proto-oncogene
NCBI Official Symbol
MDM2
NCBI Official Synonym Symbols
HDMX; hdm2; ACTFS
NCBI Protein Information
E3 ubiquitin-protein ligase Mdm2
UniProt Protein Name
E3 ubiquitin-protein ligase Mdm2
UniProt Gene Name
MDM2
UniProt Synonym Gene Names
Hdm2
UniProt Entry Name
MDM2_HUMAN

Similar Products

Product Notes

The MDM2 mdm2 (Catalog #AAA201527) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MDM2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MDM2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MDM2 mdm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EISLADYWKC TSCNEMNPPL PSHCNRCWAL RENWLPEDKG KDKGEISEKA. It is sometimes possible for the material contained within the vial of "MDM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.