Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281592_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using ME3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit ME3 Polyclonal Antibody | anti-ME3 antibody

ME3 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
ME3; NADP-ME
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
ME3, Antibody; ME3 Rabbit pAb; ME3; NADP-ME; anti-ME3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
IRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV
Applicable Applications for anti-ME3 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 505-604 of human ME3 (NP_001014811.1).
Cellular Location
Mitochondrion matrix
Positive Samples
HT-29, 293T, Mouse brain, Mouse heart, Mouse kidney, Rat brain, Rat heart, Rat kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using ME3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281592_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using ME3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human colon carcinoma using ME3 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281592_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human colon carcinoma using ME3 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded Rat ovary using ME3 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281592_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded Rat ovary using ME3 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Mouse heart using ME3 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281592_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Mouse heart using ME3 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ME3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

product-image-AAA281592_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ME3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-ME3 antibody
Background: Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. This gene encodes a mitochondrial NADP(+)-dependent isoform. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,068 Da
NCBI Official Full Name
NADP-dependent malic enzyme, mitochondrial
NCBI Official Synonym Full Names
malic enzyme 3, NADP(+)-dependent, mitochondrial
NCBI Official Symbol
ME3
NCBI Official Synonym Symbols
NADP-ME
NCBI Protein Information
NADP-dependent malic enzyme, mitochondrial; malate dehydrogenase; pyruvic-malic carboxylase; malic enzyme, NADP+-dependent, mitochondrial; mitochondrial NADP(+)-dependent malic enzyme 3
UniProt Protein Name
NADP-dependent malic enzyme, mitochondrial
UniProt Gene Name
ME3
UniProt Synonym Gene Names
NADP-ME
UniProt Entry Name
MAON_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ME3 me3 (Catalog #AAA281592) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ME3 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ME3 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ME3 me3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IRHIPDEIFL LTAEQIAQEV SEQHLSQGRL YPPLSTIRDV SLRIAIKVLD YAYKHNLASY YPEPKDKEAF VRSLVYTPDY DSFTLDSYTW PKEAMNVQTV. It is sometimes possible for the material contained within the vial of "ME3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.