Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198014_WB13.jpg WB (Western Blot) (WB Suggested Anti-Med21 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

Rabbit Med21 Polyclonal Antibody | anti-MED21 antibody

Med21 antibody - N-terminal region

Gene Names
Med21; Srb7; Surb7; D19234; AI449604; D6Ertd782e; 0610007L03Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity Purified
Synonyms
Med21, Antibody; Med21 antibody - N-terminal region; anti-MED21 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEEYAQLFAALIARTAKD
Sequence Length
144
Applicable Applications for anti-MED21 antibody
WB (Western Blot), ChIP (Chromatin immunoprecipitation)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Med21 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

product-image-AAA198014_WB13.jpg WB (Western Blot) (WB Suggested Anti-Med21 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

ChIP (Chromatin Immunoprecipitation)

(Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)

product-image-AAA198014_CHIP15.jpg ChIP (Chromatin Immunoprecipitation) (Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)
Related Product Information for anti-MED21 antibody
This is a rabbit polyclonal antibody against Med21. It was validated on Western Blot

Target Description: Med21 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Product Categories/Family for anti-MED21 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 21
NCBI Official Synonym Full Names
mediator complex subunit 21
NCBI Official Symbol
Med21
NCBI Official Synonym Symbols
Srb7; Surb7; D19234; AI449604; D6Ertd782e; 0610007L03Rik
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 21
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 21
UniProt Gene Name
Med21
UniProt Synonym Gene Names
Srb7; Surb7; RNAPII complex component SRB7
UniProt Entry Name
MED21_MOUSE

Similar Products

Product Notes

The MED21 med21 (Catalog #AAA198014) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Med21 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Med21 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ChIP (Chromatin immunoprecipitation). Researchers should empirically determine the suitability of the MED21 med21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FCNAIGVLQQ CGPPASFSNI QTAINKDQPA NPTEEYAQLF AALIARTAKD. It is sometimes possible for the material contained within the vial of "Med21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.