Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197647_WB8.jpg WB (Western Blot) (WB Suggested Anti-MED27 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Rabbit MED27 Polyclonal Antibody | anti-MED27 antibody

MED27 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
MED27; MED3; CRSP8; CRAP34; CRSP34; TRAP37
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MED27, Antibody; MED27 antibody - middle region; anti-MED27 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLD
Sequence Length
311
Applicable Applications for anti-MED27 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MED27
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MED27 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

product-image-AAA197647_WB8.jpg WB (Western Blot) (WB Suggested Anti-MED27 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

WB (Western Blot)

(Host: RabbitTarget Name: MED27Sample Type: JurkatAntibody Dilution: 1.0ug/mlMED27 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA197647_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: MED27Sample Type: JurkatAntibody Dilution: 1.0ug/mlMED27 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: MED27Sample Type: HelaAntibody Dilution: 1.0ug/mlMED27 is strongly supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA197647_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: MED27Sample Type: HelaAntibody Dilution: 1.0ug/mlMED27 is strongly supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: MED27Sample Type: 721_BAntibody Dilution: 1.0ug/mlMED27 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA197647_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MED27Sample Type: 721_BAntibody Dilution: 1.0ug/mlMED27 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: RabbitTarget Name: MED27Sample Type: 293TAntibody Dilution: 1.0ug/mlMED27 is strongly supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA197647_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MED27Sample Type: 293TAntibody Dilution: 1.0ug/mlMED27 is strongly supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-MED27 antibody
This is a rabbit polyclonal antibody against MED27. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. MED27 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 27 isoform 1
NCBI Official Synonym Full Names
mediator complex subunit 27
NCBI Official Symbol
MED27
NCBI Official Synonym Symbols
MED3; CRSP8; CRAP34; CRSP34; TRAP37
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 27
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 27
UniProt Gene Name
MED27
UniProt Synonym Gene Names
CRSP34; CRSP8; CRSP complex subunit 8
UniProt Entry Name
MED27_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MED27 med27 (Catalog #AAA197647) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MED27 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MED27 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MED27 med27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSRPNGTSAM LLVTLGKVLK VIVVMRSLFI DRTIVKGYNE NVYTEDGKLD. It is sometimes possible for the material contained within the vial of "MED27, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.