Rabbit MERTK Polyclonal Antibody | anti-MERTK antibody
MERTK Antibody - N-terminal region
Gene Names
MERTK; MER; RP38; c-Eyk; c-mer; Tyro12
Reactivity
Tested: Human; Predicted: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
MERTK, Antibody; MERTK Antibody - N-terminal region; anti-MERTK antibody
Host
Rabbit
Reactivity
Tested: Human; Predicted: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: PEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVS
Sequence Length
999
Applicable Applications for anti-MERTK antibody
WB (Western Blot)
Protein Size (# AA)
999 amino acids
Predicted Homology Based on Immunogen Sequence
Cow: 79%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MERTK
Protein Interactions
UBC; HSP90AA1; TNK2; MERTK; ITGB5; NEDD4L; IKBKG; LMO4; BMPR2; GAS6; VAV1; GRB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-MERTK antibody
This is a rabbit polyclonal antibody against MERTK. It was validated on Western Blot
Target Description: This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP).
Target Description: This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP).
Product Categories/Family for anti-MERTK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109kDa
NCBI Official Full Name
tyrosine-protein kinase Mer
NCBI Official Synonym Full Names
MER proto-oncogene, tyrosine kinase
NCBI Official Symbol
MERTK
NCBI Official Synonym Symbols
MER; RP38; c-Eyk; c-mer; Tyro12
NCBI Protein Information
tyrosine-protein kinase Mer
UniProt Protein Name
Tyrosine-protein kinase Mer
UniProt Gene Name
MERTK
UniProt Synonym Gene Names
MER
UniProt Entry Name
MERTK_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The MERTK mertk (Catalog #AAA200892) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MERTK Antibody - N-terminal region reacts with Tested: Human; Predicted: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MERTK can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MERTK mertk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PEPVNIFWVQ NSSRVNEQPE KSPSVLTVPG LTEMAVFSCE AHNDKGLTVS. It is sometimes possible for the material contained within the vial of "MERTK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
