Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198928_AD8.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

Rabbit MFAP4 Polyclonal Antibody | anti-MFAP4 antibody

MFAP4 antibody - N-terminal region

Average rating 0.0
No ratings yet
Reactivity
Tested Species Reactivity: Human, Mouse
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
MFAP4, Antibody; MFAP4 antibody - N-terminal region; anti-MFAP4 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human, Mouse
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK
Sequence Length
255
Applicable Applications for anti-MFAP4 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MFAP4
Protein Size (# AA)
255 amino acids
Protein Interactions
TP53; AURKA; GRB2; RNF115; SFTPD;
Blocking Peptide
For anti-MFAP4 (MBS3205886) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Application Data

(Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

product-image-AAA198928_AD8.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

WB (Western Blot)

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein is processed to ~26 kDa.)

product-image-AAA198928_WB10.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein is processed to ~26 kDa.)

WB (Western Blot)

(WB Suggested Anti-MFAP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

product-image-AAA198928_WB11.jpg WB (Western Blot) (WB Suggested Anti-MFAP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

IHC (Immunohiostchemistry)

(Rabbit Anti-MFAP4 antibody Catalog Number: AAA198928 Formalin Fixed Paraffin Embedded Tissue: Human LungPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec)

product-image-AAA198928_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-MFAP4 antibody Catalog Number: AAA198928 Formalin Fixed Paraffin Embedded Tissue: Human LungPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry)

(Sample Type : Mouse sciatic nervePrimary Antibody Dilution : 1:500Secondary Antibody : Biotinylated Anti-Rabbit 1:1000 followed by avidin-biotin and diaminobenzidineSecondary Antibody Dilution : 1:1000Gene Name : MFAP4 Submitted by :Beth Friedman, Ph.D., Project Scientist, Department of Pharmacology, UCSD School of Medicine, San Diego, CA)

product-image-AAA198928_IHC15.jpg IHC (Immunohistochemistry) (Sample Type : Mouse sciatic nervePrimary Antibody Dilution : 1:500Secondary Antibody : Biotinylated Anti-Rabbit 1:1000 followed by avidin-biotin and diaminobenzidineSecondary Antibody Dilution : 1:1000Gene Name : MFAP4 Submitted by :Beth Friedman, Ph.D., Project Scientist, Department of Pharmacology, UCSD School of Medicine, San Diego, CA)
Related Product Information for anti-MFAP4 antibody
This is a rabbit polyclonal antibody against MFAP4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MFAP4 is a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene encoding MFAP4 is located within the Smith-Magenis syndrome region.This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
microfibril-associated glycoprotein 4 isoform 2
NCBI Official Synonym Full Names
microfibril associated protein 4
NCBI Official Symbol
MFAP4
NCBI Protein Information
microfibril-associated glycoprotein 4
UniProt Protein Name
Microfibril-associated glycoprotein 4
UniProt Gene Name
MFAP4
UniProt Entry Name
MFAP4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MFAP4 mfap4 (Catalog #AAA198928) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MFAP4 antibody - N-terminal region reacts with Tested Species Reactivity: Human, Mouse Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's MFAP4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MFAP4 mfap4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TEGGKWTVFQ KRFNGSVSFF RGWNDYKLGF GRADGEYWLG LQNMHLLTLK. It is sometimes possible for the material contained within the vial of "MFAP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.