Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46403_WB15.jpg WB (Western Blot) (Western blot analysis of MGA expression in HELA whole cell lysates (lane 1), MCF-7 whole cell lysates (lane 2) and SW620 whole cell lysates (lane 3). MGA at 334KD was detected using rabbit anti- MGA Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

anti-Human MGA Polyclonal Antibody | anti-MGA antibody

Anti-MGA Antibody

Gene Names
MGA; MAD5; MXD5
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
MGA, Antibody; Anti-MGA Antibody; MAX gene-associated protein; MAD5; MAX dimerization protein 5; MAX gene associated; MAX gene associated protein; Max interacting protein; MGAM; MXD5; MGA, MAX dimerization protein; anti-MGA antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
2856
Applicable Applications for anti-MGA antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MGA (2376-2415aa QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH), different from the related mouse sequence by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Western blot analysis of MGA expression in HELA whole cell lysates (lane 1), MCF-7 whole cell lysates (lane 2) and SW620 whole cell lysates (lane 3). MGA at 334KD was detected using rabbit anti- MGA Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46403_WB15.jpg WB (Western Blot) (Western blot analysis of MGA expression in HELA whole cell lysates (lane 1), MCF-7 whole cell lysates (lane 2) and SW620 whole cell lysates (lane 3). MGA at 334KD was detected using rabbit anti- MGA Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-MGA antibody
Description: Rabbit IgG polyclonal antibody for MAX gene-associated protein(MGA) detection. Tested with WB in Human.

Background: Mga is a DNA-binding protein that activates the expression of several important virulence genes in Streptococcus pyogenes (group A Streptococcus, GAS) in response to changing environmental conditions. It had been found that the mouse transcription factor Max interacted with Mga. Coimmunoprecipitation analysis confirmed that Max and Mga interacted in transfected HEK293 cells. EMSA revealed that Mga required Max for binding to the E-box sequence CACGTG. The isolated T-box of Mga bound the brachyury T-box-binding site in the absence of Max. Mga repressed transcription of a reporter driven from a T-box-binding site, but coexpression of Mga with Max caused transcriptional activation from the T-box-binding site. Expression of Mga with Max, but not Mga alone, activated transcription from a reporter containing the E-box site.
References
1. Hurlin, P. J., Steingrimsson, E., Copeland, N. G., Jenkins, N. A., Eisenman, R. N. Mga, a dual-specificity transcription factor that interacts with Max and contains a T-domain DNA-binding motif. EMBO J. 18: 7019-7028, 1999. Note: Erratum: EMBO J. 19: 3841 only, 2000. 2. McIver KS, Myles RL (March 2002). "Two DNA-binding domains of Mga are required for virulence gene activation in the group A streptococcus". Mol. Microbiol. 43 (6): 1591-601.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
336,159 Da
NCBI Official Full Name
MAX gene-associated protein isoform 2
NCBI Official Synonym Full Names
MGA, MAX dimerization protein
NCBI Official Symbol
MGA
NCBI Official Synonym Symbols
MAD5; MXD5
NCBI Protein Information
MAX gene-associated protein
UniProt Protein Name
MAX gene-associated protein
UniProt Gene Name
MGA
UniProt Synonym Gene Names
KIAA0518; MAD5
UniProt Entry Name
MGAP_HUMAN

Similar Products

Product Notes

The MGA mga (Catalog #AAA46403) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-MGA Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MGA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MGA mga for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MGA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.