Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200168_WB10.jpg WB (Western Blot) (WB Suggested Anti-MICALL1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit anti-Goat, Human MICALL1 Polyclonal Antibody | anti-MICALL1 antibody

MICALL1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
MICALL1; MIRAB13; MICAL-L1
Reactivity
Goat, Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
MICALL1, Antibody; MICALL1 antibody - N-terminal region; anti-MICALL1 antibody
Ordering
Host
Rabbit
Reactivity
Goat, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVP
Sequence Length
863
Applicable Applications for anti-MICALL1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Goat: 82%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MICALL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MICALL1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

product-image-AAA200168_WB10.jpg WB (Western Blot) (WB Suggested Anti-MICALL1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

WB (Western Blot)

(Host: RabbitTarget Name: MICALL1Sample Type: HepG2Antibody Dilution: 1.0ug/mlMICALL1 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA200168_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: MICALL1Sample Type: HepG2Antibody Dilution: 1.0ug/mlMICALL1 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: MICALL1Sample Type: 293TAntibody Dilution: 1.0ug/mlMICALL1 is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA200168_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MICALL1Sample Type: 293TAntibody Dilution: 1.0ug/mlMICALL1 is supported by BioGPS gene expression data to be expressed in HEK293T)

IHC (Immunohistochemistry)

(Rabbit Anti-MICALL1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA200168_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-MICALL1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-MICALL1 antibody
This is a rabbit polyclonal antibody against MICALL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MICALL1 contains 1 CH (calponin-homology) domain and 1 LIM zinc-binding domain. It may be a cytoskeletal regulator.
Product Categories/Family for anti-MICALL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
MICAL-like protein 1
NCBI Official Synonym Full Names
MICAL like 1
NCBI Official Symbol
MICALL1
NCBI Official Synonym Symbols
MIRAB13; MICAL-L1
NCBI Protein Information
MICAL-like protein 1
UniProt Protein Name
MICAL-like protein 1
UniProt Gene Name
MICALL1
UniProt Synonym Gene Names
KIAA1668; MIRAB13; MIRab13
UniProt Entry Name
MILK1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MICALL1 micall1 (Catalog #AAA200168) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MICALL1 antibody - N-terminal region reacts with Goat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's MICALL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MICALL1 micall1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ENGPEEGTFV CAEHCARLGP GTRSGTRPGP FSQPKQQHQQ QLAEDAKDVP. It is sometimes possible for the material contained within the vial of "MICALL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.