Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46751_IHC10.jpg IHC (Immunohistochemistry) (MMP11 was detected in paraffin-embedded sections of human appendicitis tissues using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit MMP11 Polyclonal Antibody | anti-MMP11 antibody

Anti-MMP11 Antibody

Gene Names
MMP11; ST3; SL-3; STMY3
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
MMP11, Antibody; Anti-MMP11 Antibody; MMP-11; Mmp11; SL 3; SL-3; SL3; ST3; STMY3; Stromelysin 3; Stromelysin III; Stromelysin-3; P24347; matrix metallopeptidase 11; anti-MMP11 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
488
Applicable Applications for anti-MMP11 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104-135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(MMP11 was detected in paraffin-embedded sections of human appendicitis tissues using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46751_IHC10.jpg IHC (Immunohistochemistry) (MMP11 was detected in paraffin-embedded sections of human appendicitis tissues using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(MMP11 was detected in paraffin-embedded sections of rat spleen tissues using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46751_IHC11.jpg IHC (Immunohistochemisry) (MMP11 was detected in paraffin-embedded sections of rat spleen tissues using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(MMP11 was detected in paraffin-embedded sections of mouse spleen tissues using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46751_IHC13.jpg IHC (Immunohiostchemistry) (MMP11 was detected in paraffin-embedded sections of mouse spleen tissues using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of MMP11 expression in rat spleen extract (lane 1) and MM231 whole cell lysates (lane 2). MMP11 at 55KD was detected using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46751_WB15.jpg WB (Western Blot) (Western blot analysis of MMP11 expression in rat spleen extract (lane 1) and MM231 whole cell lysates (lane 2). MMP11 at 55KD was detected using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-MMP11 antibody
Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection.
Background: Stromelysin-3 (SL-3) also known as matrix metalloproteinase-11 (MMP-11) is an enzyme that in humans is encoded by the MMP11 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the enzyme encoded by this gene is activated intracellularly by furin within the constitutive secretory pathway. Also in contrast to other MMP's, this enzyme cleaves alpha 1-proteinase inhibitor but weakly degrades structural proteins of the extracellular matrix.
References
1. "Entrez Gene: MMP11 matrix metallopeptidase 11 (stromelysin 3)".
2. Anglard P, Melot T, Guerin E, Thomas G, Basset P (Oct 1995). "Structure and promoter characterization of the human stromelysin-3 gene". J Biol Chem. 270 (35): 20337-44.
3. Levy A, Zucman J, Delattre O, Mattei MG, Rio MC, Basset P (Aug 1992). "Assignment of the human stromelysin 3 (STMY3) gene to the q11.2 region of chromosome 22". Genomics. 13 (3): 881-3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,590 Da
NCBI Official Full Name
stromelysin-3 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 11
NCBI Official Symbol
MMP11
NCBI Official Synonym Symbols
ST3; SL-3; STMY3
NCBI Protein Information
stromelysin-3
UniProt Protein Name
Stromelysin-3
UniProt Gene Name
MMP11
UniProt Synonym Gene Names
STMY3; SL-3; ST3; MMP-11

Similar Products

Product Notes

The MMP11 mmp11 (Catalog #AAA46751) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-MMP11 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MMP11 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MMP11 mmp11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MMP11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.