Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281715_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of rat trachea using MMP13 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit MMP13 Polyclonal Antibody | anti-MMP13 antibody

[KO Validated] MMP13 Rabbit pAb

Gene Names
MMP13; CLG3; MANDP1
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
MMP13, Antibody; [KO Validated] MMP13 Rabbit pAb; MMP13; CLG3; MANDP1; MDST; MMP-13; anti-MMP13 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
IQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Applicable Applications for anti-MMP13 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 262-471 of human MMP13 (NP_002418.1).
Cellular Location
Secreted, extracellular matrix, extracellular space
Positive Samples
293T, HeLa, MCF7, A-549
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of rat trachea using MMP13 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281715_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of rat trachea using MMP13 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts from normal (control) and MMP13 knockout (KO) 293T cells, using MMP13 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA281715_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from normal (control) and MMP13 knockout (KO) 293T cells, using MMP13 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using MMP13 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA281715_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using MMP13 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-MMP13 antibody
Background: This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,820 Da
NCBI Official Full Name
collagenase 3 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 13 (collagenase 3)
NCBI Official Symbol
MMP13
NCBI Official Synonym Symbols
CLG3; MANDP1
NCBI Protein Information
collagenase 3; MMP-13; matrix metalloproteinase 13 (collagenase 3)
UniProt Protein Name
Collagenase 3
UniProt Gene Name
MMP13
UniProt Synonym Gene Names
MMP-13
UniProt Entry Name
MMP13_HUMAN

Similar Products

Product Notes

The MMP13 mmp13 (Catalog #AAA281715) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] MMP13 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MMP13 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the MMP13 mmp13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IQSLYGPGDE DPNPKHPKTP DKCDPSLSLD AITSLRGETM IFKDRFFWRL HPQQVDAELF LTKSFWPELP NRIDAAYEHP SHDLIFIFRG RKFWALNGYD ILEGYPKKIS ELGLPKEVKK ISAAVHFEDT GKTLLFSGNQ VWRYDDTNHI MDKDYPRLIE EDFPGIGDKV DAVYEKNGYI YFFNGPIQFE YSIWSNRIVR VMPANSILWC. It is sometimes possible for the material contained within the vial of "MMP13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.