Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197330_WB10.jpg WB (Western Blot) (WB Suggested Anti-MMP19 Antibody Titration: 5.0-10.0ug/mlPositive Control: HepG2 cell lysate)

Rabbit MMP19 Polyclonal Antibody | anti-MMP19 antibody

MMP19 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
MMP19; CODA; MMP18; RASI-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
MMP19, Antibody; MMP19 antibody - C-terminal region; anti-MMP19 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGS
Sequence Length
508
Applicable Applications for anti-MMP19 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MMP19
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MMP19 Antibody Titration: 5.0-10.0ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA197330_WB10.jpg WB (Western Blot) (WB Suggested Anti-MMP19 Antibody Titration: 5.0-10.0ug/mlPositive Control: HepG2 cell lysate)

IHC (Immunohistochemisry)

(Sample Type :Control-Human small intestine, Sample-Human colorectal cancerPrimary Antibody Dilution :1:100Secondary Antibody :Biotinylated pig anti-rabbit+streptavidin-HRPColor/Signal Descriptions :MMP19: Brown DAPI:BlueGene Name :MMP19 Submitted by :Department of Pathology, Hospital de Carabineros de Chile, Santiago, Chile)

product-image-AAA197330_IHC11.jpg IHC (Immunohistochemisry) (Sample Type :Control-Human small intestine, Sample-Human colorectal cancerPrimary Antibody Dilution :1:100Secondary Antibody :Biotinylated pig anti-rabbit+streptavidin-HRPColor/Signal Descriptions :MMP19: Brown DAPI:BlueGene Name :MMP19 Submitted by :Department of Pathology, Hospital de Carabineros de Chile, Santiago, Chile)

IHC (Immunohiostchemistry)

(Human urinary bladder)

product-image-AAA197330_IHC13.jpg IHC (Immunohiostchemistry) (Human urinary bladder)

IHC (Immunohistochemistry)

(Human Liver)

product-image-AAA197330_IHC15.jpg IHC (Immunohistochemistry) (Human Liver)
Related Product Information for anti-MMP19 antibody
This is a rabbit polyclonal antibody against MMP19. It was validated on Western Blot and immunohistochemistry

Target Description: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The function of the protein encoded by this gene has not been determined. This gene was previously referred to as MMP18 but has been renamed matrix metalloproteinase 19 (MMP19). Multiple transcript variants encoding distict isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
matrix metalloproteinase-19 isoform 1 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 19
NCBI Official Symbol
MMP19
NCBI Official Synonym Symbols
CODA; MMP18; RASI-1
NCBI Protein Information
matrix metalloproteinase-19
UniProt Protein Name
Matrix metalloproteinase-19
UniProt Gene Name
MMP19
UniProt Synonym Gene Names
MMP18; RASI; MMP-19; MMP-18
UniProt Entry Name
MMP19_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MMP19 mmp19 (Catalog #AAA197330) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP19 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MMP19 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MMP19 mmp19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IHFFKGDKVW RYINFKMSPG FPKKLNRVEP NLDAALYWPL NQKVFLFKGS. It is sometimes possible for the material contained within the vial of "MMP19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.