Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201731_WB8.jpg WB (Western Blot) (Lanes:Lane 1: 15ug MDA-MB-231 lysateLane 2: 15ug MCF7 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:10,000Gene Name:MMP2Submitted by:Katarzyna Augoff, University of Wroclaw)

Rabbit MMP2 Polyclonal Antibody | anti-MMP2 antibody

MMP2 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
MMP2; CLG4; MONA; CLG4A; MMP-2; TBE-1; MMP-II
Reactivity
Tested: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
MMP2, Antibody; MMP2 antibody - C-terminal region; anti-MMP2 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
Sequence Length
660
Applicable Applications for anti-MMP2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MMP2
Protein Size (#AA)
660 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Lanes:Lane 1: 15ug MDA-MB-231 lysateLane 2: 15ug MCF7 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:10,000Gene Name:MMP2Submitted by:Katarzyna Augoff, University of Wroclaw)

product-image-AAA201731_WB8.jpg WB (Western Blot) (Lanes:Lane 1: 15ug MDA-MB-231 lysateLane 2: 15ug MCF7 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:10,000Gene Name:MMP2Submitted by:Katarzyna Augoff, University of Wroclaw)

WB (Western Blot)

(Host: RabbitTarget Name: MMP2Sample Type: Human LungIsoform 3: 66kDaIsoform 2: 69kDaAntibody Dilution: 1.0ug/ml)

product-image-AAA201731_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: MMP2Sample Type: Human LungIsoform 3: 66kDaIsoform 2: 69kDaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MMP2Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201731_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: MMP2Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-MMP2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201731_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-MMP2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(MMP1 in connective tissue in ovarian carcinoma was detected using HRP/DAB brown color stain.Recommended for IHC on human tissue.Working dilution 2-10 ug/mL)

product-image-AAA201731_IHC15.jpg IHC (Immunohistochemistry) (MMP1 in connective tissue in ovarian carcinoma was detected using HRP/DAB brown color stain.Recommended for IHC on human tissue.Working dilution 2-10 ug/mL)
Related Product Information for anti-MMP2 antibody
This is a rabbit polyclonal antibody against MMP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MMP-2 is involved in the cleavage of gelatin type I and collagen types IV, V, VII, X.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
72 kDa type IV collagenase isoform 1 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 2
NCBI Official Symbol
MMP2
NCBI Official Synonym Symbols
CLG4; MONA; CLG4A; MMP-2; TBE-1; MMP-II
NCBI Protein Information
72 kDa type IV collagenase
UniProt Protein Name
72 kDa type IV collagenase
UniProt Gene Name
MMP2
UniProt Synonym Gene Names
CLG4A; MMP-2
UniProt Entry Name
MMP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MMP2 mmp2 (Catalog #AAA201731) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP2 antibody - C-terminal region reacts with Tested: Human Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's MMP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MMP2 mmp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AWNAIPDNLD AVVDLQGGGH SYFFKGAYYL KLENQSLKSV KFGSIKSDWL. It is sometimes possible for the material contained within the vial of "MMP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.