Rabbit MMP20 Polyclonal Antibody | anti-MMP20 antibody
MMP20 antibody - middle region
Gene Names
MMP20; AI2A2; MMP-20
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MMP20, Antibody; MMP20 antibody - middle region; anti-MMP20 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA
Sequence Length
483
Applicable Applications for anti-MMP20 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MMP20
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-MMP20 antibody
This is a rabbit polyclonal antibody against MMP20. It was validated on Western Blot
Target Description: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP20 degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in the gene encoding MMP20, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta.
Target Description: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP20 degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in the gene encoding MMP20, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta.
Product Categories/Family for anti-MMP20 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
matrix metalloproteinase-20 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 20
NCBI Official Symbol
MMP20
NCBI Official Synonym Symbols
AI2A2; MMP-20
NCBI Protein Information
matrix metalloproteinase-20
UniProt Protein Name
Matrix metalloproteinase-20
UniProt Gene Name
MMP20
UniProt Synonym Gene Names
MMP-20
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
MMP20 Antibody
Host: Rabbit
Reactivity: Human, Mouse
Apps: Immunohistochemistry, Western Blot, ELISA
MMP20 Recombinant Protein
Host: E.coli
Reactivity: Mus musculus (Mouse)
Apps: Western Blot, SDS-Page
Product Notes
The MMP20 mmp20 (Catalog #AAA199713) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP20 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MMP20 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MMP20 mmp20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAVYLREPQK TLFFVGDEYY SYDERKRKME KDYPKNTEEE FSGVNGQIDA. It is sometimes possible for the material contained within the vial of "MMP20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
