Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46223_WB13.jpg WB (Western Blot) (Anti- MMP3 Picoband antibody, AAA46223, Western blottingAll lanes: Anti MMP3 (AAA46223) at 0.5ug/mlLane 1: Human Placenta Tissue Lysate at 50ugLane 2: U20S Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: PANC Whole Cell Lysate at 40ugLane 5: COLO320 Whole Cell Lysate at 40ugPredicted bind size: 54KDObserved bind size: 54KD)

anti-Human MMP3 Polyclonal Antibody | anti-MMP3 antibody

Anti-MMP3 Antibody

Average rating 0.0
No ratings yet
Gene Names
MMP3; SL-1; STMY; STR1; CHDS6; MMP-3; STMY1
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
MMP3, Antibody; Anti-MMP3 Antibody; Stromelysin-1; CHDS6; Matrix metalloproteinase 3; Matrix metalloproteinase 3 preproprotein; Matrix metalloproteinase-3; MGC126102; MGC126103; MGC126104; MMP 3; MMP-3; MMP3; MMP3_HUMAN; Progelatinase; Proteoglycanase; SL 1; SL-1; SL1; STMY; STMY1; STR1; Stromelisin 1; Stromelysin 1; Stromelysin 1 progelatinase; Transin 1; Transin-1; matrix metallopeptidase 3 (stromelysin 1, progelatinase); anti-MMP3 antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
477
Applicable Applications for anti-MMP3 antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3(410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Anti- MMP3 Picoband antibody, AAA46223, Western blottingAll lanes: Anti MMP3 (AAA46223) at 0.5ug/mlLane 1: Human Placenta Tissue Lysate at 50ugLane 2: U20S Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: PANC Whole Cell Lysate at 40ugLane 5: COLO320 Whole Cell Lysate at 40ugPredicted bind size: 54KDObserved bind size: 54KD)

product-image-AAA46223_WB13.jpg WB (Western Blot) (Anti- MMP3 Picoband antibody, AAA46223, Western blottingAll lanes: Anti MMP3 (AAA46223) at 0.5ug/mlLane 1: Human Placenta Tissue Lysate at 50ugLane 2: U20S Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: PANC Whole Cell Lysate at 40ugLane 5: COLO320 Whole Cell Lysate at 40ugPredicted bind size: 54KDObserved bind size: 54KD)

WB (Western Blot)

(Anti- MMP3 Picoband antibody, AAA46223, Western blottingAll lanes: Anti MMP3 (AAA46223) at 0.5ug/mlWB: Recombinant Human MMP3 Protein 0.5ngPredicted bind size: 36KDObserved bind size: 36KD)

product-image-AAA46223_WB15.jpg WB (Western Blot) (Anti- MMP3 Picoband antibody, AAA46223, Western blottingAll lanes: Anti MMP3 (AAA46223) at 0.5ug/mlWB: Recombinant Human MMP3 Protein 0.5ngPredicted bind size: 36KDObserved bind size: 36KD)
Related Product Information for anti-MMP3 antibody
Description: Rabbit IgG polyclonal antibody for Stromelysin-1(MMP3) detection. Tested with WB in Human.

Background: Stromelysin-1, also known as matrix metalloproteinase-3 (MMP-3), is an enzyme that in humans is encoded by the MMP3 gene. It is mapped to 11q22.2. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix and during tissue remodeling in normal physiological processes, such as embryonic development and reproduction, as well as in disease processes, such as arthritis, and tumour metastasis. The MMP-3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, MMP-3 can also activate other MMPs such as MMP-1, MMP-7, and MMP-9, rendering MMP-3 crucial in connective tissue remodeling. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation.
References
1. "Entrez Gene: MMP3 matrix metallopeptidase 3 (stromelysin 1, progelatinase) 2. Lu, P. C.-S., Ye, H., Maeda, M., Azar, D. T. Immunolocalization and gene expression of matrilysin during corneal wound healing. Invest. Ophthal. Vis. Sci. 40: 20-27, 1999. 3. Ye S, Eriksson P, Hamsten A, Kurkinen M, Humphries SE, Henney AM (May 1996). "Progression of coronary atherosclerosis is associated with a common genetic variant of the human stromelysin-1 promoter which results in reduced gene expression". J. Biol. Chem. 271 (22): 13055-60.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,977 Da
NCBI Official Full Name
stromelysin-1 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 3
NCBI Official Symbol
MMP3
NCBI Official Synonym Symbols
SL-1; STMY; STR1; CHDS6; MMP-3; STMY1
NCBI Protein Information
stromelysin-1
UniProt Protein Name
Stromelysin-1
UniProt Gene Name
MMP3
UniProt Synonym Gene Names
STMY1; SL-1; MMP-3
UniProt Entry Name
MMP3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MMP3 mmp3 (Catalog #AAA46223) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-MMP3 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MMP3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MMP3 mmp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MMP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.