IHC (Immunohistochemisry)
(Anti- MMP-8 Picoband antibody, AAA46472,IHC(P)IHC(P): Rat Spleen Tissue)
anti-Mouse, Rat MMP8 Polyclonal Antibody | anti-MMP8 antibody
Anti-MMP8 Antibody
Gene Names
Mmp8; BB138268
Reactivity
Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
MMP8, Antibody; Anti-MMP8 Antibody; Neutrophil collagenase; CLG 1; CLG1; Collagenase 1; Collagenase 1 neutrophil; HNC; Matrix metallopeptidase 8 (neutrophil collagenase); Matrix metalloprotease 8; Matrix metalloproteinase-8; MMP 8; MMP-8; Mmp8; MMP8_HUMAN; PMNL CL; PMNL collagenase; PMNL-CL; PMNLCL; matrix metallopeptidase 8 (neutrophil collagenase); anti-MMP8 antibody
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
465
Applicable Applications for anti-MMP8 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
IHC (Immunohistochemisry)
(Anti- MMP-8 Picoband antibody, AAA46472,IHC(P)IHC(P): Rat Spleen Tissue)
IHC (Immunohistochemisry)
(Anti- MMP-8 Picoband antibody, AAA46472,IHC(P)IHC(P): Rat Spleen Tissue)
IHC (Immunohiostchemistry)
(Anti- MMP-8 Picoband antibody, AAA46472,IHC(P)IHC(P): Mouse Spleen Tissue)
IHC (Immunohiostchemistry)
(Anti- MMP-8 Picoband antibody, AAA46472,IHC(P)IHC(P): Mouse Spleen Tissue)
WB (Western Blot)
(Anti- MMP-8 Picoband antibody, AAA46472, Western blottingAll lanes: Anti MMP-8 (AAA46472) at 0.5ug/mlLane 1: Mouse Testis Tissue Lysate at 50ugLane 2: NIH3T3 Whole Cell Lysate at 40ugLane 3: HEPA Whole Cell Lysate at 40ugLane 4: NRK Whole Cell Lysate at 40ugPredicted bind size: 53KDObserved bind size: 55KD)
WB (Western Blot)
(Anti- MMP-8 Picoband antibody, AAA46472, Western blottingAll lanes: Anti MMP-8 (AAA46472) at 0.5ug/mlLane 1: Mouse Testis Tissue Lysate at 50ugLane 2: NIH3T3 Whole Cell Lysate at 40ugLane 3: HEPA Whole Cell Lysate at 40ugLane 4: NRK Whole Cell Lysate at 40ugPredicted bind size: 53KDObserved bind size: 55KD)
Related Product Information for anti-MMP8 antibody
Description: Rabbit IgG polyclonal antibody for Neutrophil collagenase(MMP8) detection. Tested with WB, IHC-P, ELISA in Mouse;Rat.
Background: MMP8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58% homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57% identity with the deduced protein sequence for fibroblast collagenase with 72% chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.
Background: MMP8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58% homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57% identity with the deduced protein sequence for fibroblast collagenase with 72% chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.
References
1. Balbin, M.; Fueyo, A.; Tester, A. M.; Pendas, A. M.; Pitiot, A. S.; Astudillo, A.; Overall, C. M.; Shapiro, S. D.; Lopez-Otin, C. : Loss of collagenase-2 confers increased skin tumor susceptibility to male mice. Nature Genet. 35: 252-257, 2003. 2. Devarajan, P.; Mookhtiar, K.; Van Wart, H.; Berliner, N. : Structure and expression of the cDNA encoding human neutrophil collagenase. Blood 77: 2731-2738, 1991. 3. Hasty, K. A.; Pourmotabbed, T. F.; Goldberg, G. I.; Thompson, J. P.; Spinella, D. G.; Stevens, R. M.; Mainardi, C. L. : Human neutrophil collagenase: a distinct gene product with homology to other matrix metalloproteinases. J. Biol. Chem. 265: 11421-11424, 1990. 4. Wang, H.; Parry, S.; Macones, G.; Sammel, M. D.; Ferrand, P. E.; Kuivaniemi, H.; Tromp, G.; Halder, I.; Shriver, M. D.; Romero, R.; Strauss, J. F., III : Functionally significant SNP MMP8 promoter haplotypes and preterm premature rupture of membranes (PPROM). Hum. Molec. Genet. 13: 2659-2669, 2004.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53,126 Da
NCBI Official Full Name
neutrophil collagenase preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 8
NCBI Official Symbol
Mmp8
NCBI Official Synonym Symbols
BB138268
NCBI Protein Information
neutrophil collagenase
UniProt Protein Name
Neutrophil collagenase
UniProt Gene Name
Mmp8
UniProt Synonym Gene Names
MMP-8
UniProt Entry Name
MMP8_MOUSE
Similar Products
Product Notes
The MMP8 mmp8 (Catalog #AAA46472) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-MMP8 Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MMP8 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MMP8 mmp8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MMP8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.