Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282225_CHIP13.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts of HeLa cells, using MonoMethyl-Histone H3-K79 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

Rabbit MonoMethyl-Histone H3-K79 Polyclonal Antibody | anti-H3-K79 antibody

MonoMethyl-Histone H3-K79 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
CD96; TACTILE
Reactivity
Human, Mouse, Rat
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
MonoMethyl-Histone H3-K79, Antibody; MonoMethyl-Histone H3-K79 Rabbit pAb; H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; anti-H3-K79 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
EIPVIVENNSTDVLVERRFTCLLKNVFPKANITWFIDGSFLHDEKEGIYITNEERKGKDGFLELKSVLTRVHSNKPAQSDNLTIWCMALSPVPGNKVWNIS
Applicable Applications for anti-H3-K79 antibody
ChIP (Chromatin immunoprecipitation), WB (Western Blot)
Positive Samples
HeLa, NIH/3T3, C6, H3
Immunogen
A synthetic monomethylated peptide around K79 of human histone H3 (NP_003520.1).
Cellular Location
Chromosome, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation analysis of extracts of HeLa cells, using MonoMethyl-Histone H3-K79 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

product-image-AAA282225_CHIP13.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts of HeLa cells, using MonoMethyl-Histone H3-K79 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using MonoMethyl-Histone H3-K79 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

product-image-AAA282225_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using MonoMethyl-Histone H3-K79 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-H3-K79 antibody
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
63,888 Da
NCBI Official Full Name
T-cell surface protein tactile
NCBI Official Synonym Full Names
CD96 molecule
NCBI Official Symbol
CD96
NCBI Official Synonym Symbols
TACTILE
NCBI Protein Information
T-cell surface protein tactile
UniProt Protein Name
T-cell surface protein tactile
UniProt Gene Name
CD96

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The H3-K79 cd96 (Catalog #AAA282225) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MonoMethyl-Histone H3-K79 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MonoMethyl-Histone H3-K79 can be used in a range of immunoassay formats including, but not limited to, ChIP (Chromatin immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the H3-K79 cd96 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EIPVIVENNS TDVLVERRFT CLLKNVFPKA NITWFIDGSF LHDEKEGIYI TNEERKGKDG FLELKSVLTR VHSNKPAQSD NLTIWCMALS PVPGNKVWNI S. It is sometimes possible for the material contained within the vial of "MonoMethyl-Histone H3-K79, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.