Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197644_WB11.jpg WB (Western Blot) (WB Suggested Anti-MORF4L2 Antibody Titration: 0.2ug/mlPositive Control: Human brain)

Rabbit MORF4L2 Polyclonal Antibody | anti-MORF4L2 antibody

MORF4L2 antibody - N-terminal region

Gene Names
MORF4L2; MRGX; MORFL2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
MORF4L2, Antibody; MORF4L2 antibody - N-terminal region; anti-MORF4L2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFK
Sequence Length
288
Applicable Applications for anti-MORF4L2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MORF4L2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MORF4L2 Antibody Titration: 0.2ug/mlPositive Control: Human brain)

product-image-AAA197644_WB11.jpg WB (Western Blot) (WB Suggested Anti-MORF4L2 Antibody Titration: 0.2ug/mlPositive Control: Human brain)

IHC (Immunohiostchemistry)

(Rabbit Anti-MORF4L2 AntibodyParaffin Embedded Tissue: Human neural cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197644_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-MORF4L2 AntibodyParaffin Embedded Tissue: Human neural cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-MORF4L2 AntibodyParaffin Embedded Tissue: Human neural cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197644_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-MORF4L2 AntibodyParaffin Embedded Tissue: Human neural cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-MORF4L2 antibody
This is a rabbit polyclonal antibody against MORF4L2. It was validated on Western Blot and immunohistochemistry

Target Description: MORF4L2 is a member of the mortality factor (MORF) family of putative transcriptional regulators

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
mortality factor 4-like protein 2
NCBI Official Synonym Full Names
mortality factor 4 like 2
NCBI Official Symbol
MORF4L2
NCBI Official Synonym Symbols
MRGX; MORFL2
NCBI Protein Information
mortality factor 4-like protein 2
UniProt Protein Name
Mortality factor 4-like protein 2
UniProt Gene Name
MORF4L2
UniProt Synonym Gene Names
KIAA0026; MRGX
UniProt Entry Name
MO4L2_HUMAN

Similar Products

Product Notes

The MORF4L2 morf4l2 (Catalog #AAA197644) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MORF4L2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MORF4L2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MORF4L2 morf4l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPSGSVRKTR KNKQKTPGNG DGGSTSEAPQ PPRKKRARAD PTVESEEAFK. It is sometimes possible for the material contained within the vial of "MORF4L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.