Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199196_WB8.jpg WB (Western Blot) (WB Suggested Anti-MPP5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit MPP5 Polyclonal Antibody | anti-MPP5 antibody

MPP5 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
MPP5; PALS1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MPP5, Antibody; MPP5 antibody - N-terminal region; anti-MPP5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM
Sequence Length
675
Applicable Applications for anti-MPP5 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 80%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MPP5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MPP5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

product-image-AAA199196_WB8.jpg WB (Western Blot) (WB Suggested Anti-MPP5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: MPP5Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA199196_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: MPP5Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MPP5Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA199196_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: MPP5Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MPP5Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA199196_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MPP5Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MPP5Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA199196_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MPP5Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MPP5 antibody
This is a rabbit polyclonal antibody against MPP5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like, ZO1-like, p55-like, and LIN2-like, based on their size and the presence of additional domains. MPP5 is a member of the p55-like MAGUK subfamily.Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like (see DLG1; MIM 601014), ZO1-like (see TJP1; MIM 601009), p55-like (see MPP1; MIM 305360), and LIN2-like (see CASK; MIM 300172), based on their size and the presence of additional domains (Tseng et al., 2001 [PubMed 11311936]). MPP5 is a member of the p55-like MAGUK subfamily.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-MPP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
MAGUK p55 subfamily member 5 isoform 1
NCBI Official Synonym Full Names
membrane palmitoylated protein 5
NCBI Official Symbol
MPP5
NCBI Official Synonym Symbols
PALS1
NCBI Protein Information
MAGUK p55 subfamily member 5
UniProt Protein Name
MAGUK p55 subfamily member 5
UniProt Gene Name
MPP5
UniProt Entry Name
MPP5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MPP5 mpp5 (Catalog #AAA199196) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MPP5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MPP5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MPP5 mpp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVDCPGDLGT RMMPIRRSAQ LERIRQQQED MRRRREEEGK KQELDLNSSM. It is sometimes possible for the material contained within the vial of "MPP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.