Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199916_WB11.jpg WB (Western Blot) (WB Suggested Anti-MPST Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateMPST is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit MPST Polyclonal Antibody | anti-MPST antibody

MPST antibody - middle region

Gene Names
MPST; MST; TST2; TUM1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MPST, Antibody; MPST antibody - middle region; anti-MPST antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT
Sequence Length
297
Applicable Applications for anti-MPST antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MPST
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MPST Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateMPST is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA199916_WB11.jpg WB (Western Blot) (WB Suggested Anti-MPST Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateMPST is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: MPSTSample Type:Lane 1: 40 ug Human Liver lysateLane 2: 40 ug Mouse Liver lysateLane 3: 40 ug Rat Liver lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit secondary antibody conjugated with Alexa Fluor 647Secondary Antibody Dilution:1:2500Submitted by:Hua Jiang, University of Colorado.)

product-image-AAA199916_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MPSTSample Type:Lane 1: 40 ug Human Liver lysateLane 2: 40 ug Mouse Liver lysateLane 3: 40 ug Rat Liver lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit secondary antibody conjugated with Alexa Fluor 647Secondary Antibody Dilution:1:2500Submitted by:Hua Jiang, University of Colorado.)

WB (Western Blot)

(Host: RabbitTarget Name: MPSTSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199916_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MPSTSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-MPST antibody
This is a rabbit polyclonal antibody against MPST. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.This gene encodes a protein which can function as a monomer or as a disulfide-linked homodimer and which catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cyanide degradation and in thiosulfate biosynthesis. The encoded cytoplasmic protein is a member of the rhodanese family but is not rhodanese itself, which is a mitochondrial protein. Alternatively spliced transcript variants encoding the same protein have been identified.
Product Categories/Family for anti-MPST antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
3-mercaptopyruvate sulfurtransferase isoform 1
NCBI Official Synonym Full Names
mercaptopyruvate sulfurtransferase
NCBI Official Symbol
MPST
NCBI Official Synonym Symbols
MST; TST2; TUM1
NCBI Protein Information
3-mercaptopyruvate sulfurtransferase
UniProt Protein Name
3-mercaptopyruvate sulfurtransferase
UniProt Gene Name
MPST
UniProt Synonym Gene Names
TST2; MST
UniProt Entry Name
THTM_HUMAN

Similar Products

Product Notes

The MPST mpst (Catalog #AAA199916) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MPST antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MPST can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MPST mpst for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPAFIKTYED IKENLESRRF QVVDSRATGR FRGTEPEPRD GIEPGHIPGT. It is sometimes possible for the material contained within the vial of "MPST, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.