WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and MRPL53 knockdown (KD) HeLa cells using [KD Validated] MRPL53 Rabbit pAb (AAA283287) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Rabbit anti-Human MRPL53 Polyclonal Antibody | anti-MRPL53 antibody
[KD Validated] MRPL53 Rabbit pAb
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
MRPL53, Antibody; [KD Validated] MRPL53 Rabbit pAb; mL53; L53MT; anti-MRPL53 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MAAALARLGLRPVKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALEMLTAFASHIRARDAAGSGDKPGADTGR
Applicable Applications for anti-MRPL53 antibody
ELISA, WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of human MRPL53 (NP_444278.1-).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and MRPL53 knockdown (KD) HeLa cells using [KD Validated] MRPL53 Rabbit pAb (AAA283287) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and MRPL53 knockdown (KD) HeLa cells using [KD Validated] MRPL53 Rabbit pAb (AAA283287) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of lysates from A549 cells using [KD Validated] MRPL53 Rabbit pAb (AAA283287) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of lysates from A549 cells using [KD Validated] MRPL53 Rabbit pAb (AAA283287) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-MRPL53 antibody
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 1p.
Product Categories/Family for anti-MRPL53 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 12kDa
Observed MW: 12kDa
Observed MW: 12kDa
UniProt Protein Name
39S ribosomal protein L53, mitochondrial
UniProt Gene Name
MRPL53
UniProt Synonym Gene Names
L53mt; MRP-L53
UniProt Entry Name
RM53_HUMAN
Similar Products
Product Notes
The MRPL53 mrpl53 (Catalog #AAA283287) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] MRPL53 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MRPL53 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the MRPL53 mrpl53 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAALARLGL RPVKQVRVQF CPFEKNVEST RTFLQTVSSE KVRSTNLNCS VIADVRHDGS EPCVDVLFGD GHRLIMRGAH LTALEMLTAF ASHIRARDAA GSGDKPGADT GR. It is sometimes possible for the material contained within the vial of "MRPL53, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.