Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201454_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MRPS5Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit MRPS5 Polyclonal Antibody | anti-MRPS5 antibody

MRPS5 Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
MRPS5; S5mt; MRP-S5
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MRPS5, Antibody; MRPS5 Antibody - N-terminal region; anti-MRPS5 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: ETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAV
Sequence Length
430
Applicable Applications for anti-MRPS5 antibody
WB (Western Blot)
Predicted Homology
Cow: 93%; Dog: 86%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRPS5
Protein Size (# AA)
430 amino acids
Protein Interactions
TP53; SUMO2; UBC; C1QBP; MRPL24; TMEM43; MRPS35; MRPS10; ZMPSTE24; FLOT1; UQCRFS1P1; TUFM; SDHB; ILF3; GALNT2; EEF2; CORO1C; CAND1; CUL3; ICT1; DDX56;
Blocking Peptide
For anti-MRPS5 antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: MRPS5Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201454_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MRPS5Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MRPS5 antibody
Target Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S5P family. Pseudogenes corresponding to this gene are found on chromosomes 4q, 5q, and 18q.
Product Categories/Family for anti-MRPS5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
28S ribosomal protein S5, mitochondrial isoform a
NCBI Official Synonym Full Names
mitochondrial ribosomal protein S5
NCBI Official Symbol
MRPS5
NCBI Official Synonym Symbols
S5mt; MRP-S5
NCBI Protein Information
28S ribosomal protein S5, mitochondrial
UniProt Protein Name
28S ribosomal protein S5, mitochondrial
UniProt Gene Name
MRPS5
UniProt Synonym Gene Names
MRP-S5; S5mt
UniProt Entry Name
RT05_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MRPS5 mrps5 (Catalog #AAA201454) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRPS5 Antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MRPS5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MRPS5 mrps5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETGAGAKKGR GKRTKKKKRK DLNRGQIIGE GRYGFLWPGL NVPLMKNGAV. It is sometimes possible for the material contained within the vial of "MRPS5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.