Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198824_WB13.jpg WB (Western Blot) (WB Suggested Anti-MSI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

Rabbit MSI2 Polyclonal Antibody | anti-MSI2 antibody

MSI2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
MSI2; MSI2H
Reactivity
Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MSI2, Antibody; MSI2 antibody - N-terminal region; anti-MSI2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECM
Sequence Length
328
Applicable Applications for anti-MSI2 antibody
WB (Western Blot)
Homology
Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MSI2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MSI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

product-image-AAA198824_WB13.jpg WB (Western Blot) (WB Suggested Anti-MSI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

WB (Western Blot)

(MSI2 antibody - N-terminal region validated by WB using K562 cells lysate at 1:1000.)

product-image-AAA198824_WB15.jpg WB (Western Blot) (MSI2 antibody - N-terminal region validated by WB using K562 cells lysate at 1:1000.)
Related Product Information for anti-MSI2 antibody
This is a rabbit polyclonal antibody against MSI2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Two transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-MSI2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
RNA-binding protein Musashi homolog 2 isoform a
NCBI Official Synonym Full Names
musashi RNA binding protein 2
NCBI Official Symbol
MSI2
NCBI Official Synonym Symbols
MSI2H
NCBI Protein Information
RNA-binding protein Musashi homolog 2
UniProt Protein Name
RNA-binding protein Musashi homolog 2
UniProt Gene Name
MSI2
UniProt Synonym Gene Names
Musashi-2
UniProt Entry Name
MSI2H_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MSI2 msi2 (Catalog #AAA198824) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MSI2 antibody - N-terminal region reacts with Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MSI2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MSI2 msi2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EANGSQGTSG SANDSQHDPG KMFIGGLSWQ TSPDSLRDYF SKFGEIRECM. It is sometimes possible for the material contained within the vial of "MSI2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.